Cat: PA1000-8675

Recombinant Human TFPI Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    TFPI

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    TFPI;LACI;TFPI1;Tissue factor pathway inhibitor

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P10646-2

  • Expression Region

    152-251aa

  • AA Sequence

    RFKYGGCLGNMNNFETLEECKNICEDGPNGFQVDNYGTQLNAVNNSLTPQ STKVPSLFVTKEGTNDGWKSAAHIYQVFLNAFCIHASMFFLGLDSISCLC

  • Molecular Weight

    37 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Tissue Factor Pathway Inhibitor (TFPI) is a critical protein that regulates hemostasis by inhibiting the extrinsic pathway of coagulation. Its primary function is to bind to the tissue factor-factor VIIa complex, thereby preventing the activation of factor X and ultimately inhibiting thrombin generation. The importance of TFPI in maintaining the balance between coagulation and fibrinolysis has made it a focal point of research, particularly in the context of thrombotic disorders and cardiovascular diseases. Studies have shown that altered levels of TFPI can contribute to various pathological conditions, including venous thromboembolism and atherosclerosis. Additionally, TFPI has been implicated in cancer biology, where tumor cells may exploit coagulation pathways for growth and metastasis. The production of recombinant TFPI proteins has provided a valuable tool for both therapeutic and research applications, allowing for the examination of its biological functions and potential as a therapeutic agent. Given the complexities of coagulation pathways and the role of TFPI as a natural inhibitor, ongoing research aims to elucidate its mechanisms of action and explore its possibilities in clinical applications, including the development of novel anticoagulant therapies. This area of study holds promise for improving outcomes in patients at risk for thrombotic events, making TFPI an important target in the fields of hematology and cardiology.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US