Analytical Data
-
Gene name
ADIPOR2
- Application
-
Alternative Names
ADIPOR2；PAQR2；Adiponectin receptor Protein 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q86V24
-
Expression Region
1-386aa
-
AA Sequence
MNEPTENRLGCSRTPEPDIRLRKGHQLDGTRRGDNDSHQGDLEPILEASVLSSHHKKSSEEHEYSDEAPQEDEGFMGMSPLLQAHHAMEKMEEFVCKVWEGRWRVIPHDVLPDWLKDNDFLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGCVFFLCLGIFYMFRPNISFVAPLQEKVVFGLFFLGAILCLSFSWLFHTVYCHSEGVSRLFSKLDYSGIALLIMGSFVPWLYYSFYCNPQPCFIYLIVICVLGIAAIIVSQWDMFATPQYRGVRAGVFLGLGLSGIIPTLHYVISEGFLKAATIGQIGWLMLMASLYITGAALYAARIPERFFPGKCDIWFHSHQLFHIFVVAGAFVHFHGVSNLQEFRFMIGGGCSEEDAL
-
Molecular Weight
43.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ADIPOR2, or adiponectin receptor 2, is a crucial component of the adiponectin signaling pathway, which plays a significant role in regulating glucose metabolism, lipid metabolism, and insulin sensitivity. Research has shown that adiponectin, a hormone secreted by adipose tissue, exerts protective effects against obesity-related metabolic disorders. The ADIPOR2 receptor is predominantly expressed in skeletal muscle and liver, making it a focal point in studying metabolic diseases such as type 2 diabetes and cardiovascular disorders. Given the increasing prevalence of these conditions, understanding the functional properties of ADIPOR2 is essential for developing novel therapeutic strategies. Recombinant protein studies provide valuable insights into the receptor's structure, binding kinetics, and downstream signaling pathways, potentially revealing targets for drug development. Recent advancements in biotechnology allow for the generation of ADIPOR2 in a purified form, enabling detailed investigations into its biological functions and interactions with adiponectin. By elucidating the role of ADIPOR2 in metabolism, researchers aim to identify mechanisms that could lead to innovative treatments for metabolic syndrome and associated diseases.
