Cat: PA3000-1080

Recombinant Human CEMIP2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CEMIP2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Cemip2; Kiaa1412

  • Species

    Human

  • Source

    E. coli

  • Tag

    N-terminal His and TRxA Tag

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9UHN6

  • Expression Region

    104-250aa

  • AA Sequence

    SSKYAPDENCPDQNPRLRNWDPGQDSAKQVVIKEGDMLRLTSDATVHSIVIQDGGLLVFGDNKDGSRNITLRTHYILIQDGGALHIGAEKCRYKSKATITLYGKSDEGESMPTFGKKFIGVEAGGTLELHGARKASWTLLARTLNSS

  • Molecular Weight

    18.0 KDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CEMIP2, or Cell Migration-Inducing and Hyaluronan-Binding Protein 2, is a member of the KIAA1199 gene family, which has garnered attention due to its role in various cellular processes, including cell migration, proliferation, and extracellular matrix remodeling. Research indicates that CEMIP2 is involved in the regulation of hyaluronic acid metabolism, a key component of the extracellular matrix, which contributes to tissue hydration and cell signaling. Elevated levels of CEMIP2 have been implicated in several pathological conditions, including cancer, where it appears to facilitate tumor progression and metastasis by promoting epithelial-mesenchymal transition (EMT) and enhancing cell migratory properties. Moreover, CEMIP2's interaction with inflammatory signaling pathways highlights its potential involvement in chronic inflammatory diseases. The study of CEMIP2 as a recombinant protein aims to elucidate its functional roles and molecular mechanisms. By producing CEMIP2 in vitro, researchers can investigate its biochemical properties and interactions with other cellular components, paving the way for therapeutic applications. Understanding CEMIP2's mechanisms could lead to novel strategies for targeting tumor metastasis and other diseases characterized by excessive cell migration and matrix remodeling. Thus, CEMIP2 represents a promising candidate for further research in fields ranging from oncology to regenerative medicine, highlighting the importance of this protein in both health and disease contexts.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US