Cat: PA3000-1084

Recombinant Mouse Psmc1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Psmc1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    P26s4; 26S proteasome AAA-ATPase subunit RPT2

  • Species

    Mouse

  • Source

    E. coli

  • Tag

    N-terminal His and Tag

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P62192

  • Expression Region

    1-440aa

  • AA Sequence

    MGQSQSGGHGPGGGKKDDKDKKKKYEPPVPTRVGKKKKKTKGPDAASKLPLVTP HTQCRLKLLKLERIKDYLLMEEEFIRNQEQMKPLEEKQEEERSKVDDLRGTPMS VGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDLLEPGCSVLLNHKVHAVIGV LMDDTDPLVTVMKVEKAPQETYADIGGLDNQIQEIKESVELPLTHPEYYEEMGI KPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVREL FRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRGD VKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKKRIFQIHTSRMTLADDV TLDDLIMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKENVLYKKQE GTPEGLYL

  • Molecular Weight

    52.5 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Psmc1, also known as Proteasome 26S subunit, is a vital component of the 26S proteasome, which plays a crucial role in the ubiquitin-proteasome pathway responsible for protein degradation within cells. This pathway maintains proteostasis, regulates various cellular processes, and is involved in the degradation of misfolded or damaged proteins, thereby preventing the accumulation of potentially toxic aggregates. Research into Psmc1 has gained significant attention due to its implications in several diseases, including cancer and neurodegenerative disorders, where proteasomal dysfunction is often observed. Psmc1 functions as part of the ATPase complex in the proteasome, facilitating the unfolding and translocation of substrates into the catalytic core for degradation. Given its essential role in cellular homeostasis, understanding the structure and function of Psmc1 through recombinant protein studies is pivotal. Such studies enhance our knowledge of proteasome regulation and its interactions with various substrates, paving the way for therapeutic interventions that target the proteasome system. Researchers are focusing on the production and characterization of recombinant Psmc1 to explore its mechanistic roles and potential as a target for drug development, particularly in conditions marked by proteasome inhibition or dysfunction.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US