Cat: IPD-X50134

Recombinant Human RBP4 Protein , HEK293

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    RBP4

  • 简介

    RBP4 protein acts as a retinol-binding protein, essential for transporting retinol in blood plasma. It facilitates the delivery of retinol from the liver to peripheral tissues and likely transfers bound all-trans retinol to STRA6 for cell membrane transport. Interactions with TTR prevent kidney glomeruli filtration loss. Direct interaction with STRA6 underscores RBP4's role in intricate retinol transport and distribution processes in the body. RBP4 Protein, Human (HEK293, C-His) is the recombinant human-derived RBP4 protein, expressed by HEK293 , with C-6*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Plasma retinol-binding protein; PRBP; RBP;

  • Species

    Human

  • Source

    HEK293

  • Tag

    No Tag

  • Purity

    Greater than 95% as determined by SDS-PAGE.

  • Uniprot

    P02753

  • Expression Region

    19-201aa

  • AA Sequence

    ERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLL

  • Molecular Weight

    115 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Retinol-binding protein 4 (RBP4) is a 21-kDa protein primarily synthesized in the liver and adipose tissue, playing a crucial role in the transport of retinol (vitamin A) from the liver to peripheral tissues. Elevated levels of RBP4 have been implicated in various metabolic disorders, including insulin resistance, obesity, and type 2 diabetes, making it a compelling target for researching potential therapeutic interventions. Understanding the structure and function of RBP4 is essential, as it may reveal insights into the mechanisms of retinol metabolism and its influence on metabolic pathways. Recombinant RBP4 protein has become a valuable tool for investigating its biological functions and interactions at the molecular level. Researchers utilize techniques such as genetic engineering and affinity chromatography to produce and purify RBP4, enabling detailed studies of its physiological role and potential as a biomarker for metabolic disease. This growing body of research aims to elucidate the complex relationships between RBP4, retinol transport, and metabolic health, with the ultimate goal of developing novel strategies for disease prevention and treatment. As RBP4 continues to garner attention in the scientific community, its significance in metabolic regulation and potential as a therapeutic target underscores the need for continued exploration of this intriguing protein.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US