Analytical Data
-
Gene name
SLC38A2
- Application
-
Alternative Names
Amino acid transporter 2; Amino acid transporter A2; ATA2; KIAA1382; PRO1068; Protein 40-9-1; S38A2_HUMAN; SAT2; Slc38a2; SNAT2; Sodium-coupled neutral amino acid transporter 2; Solute carrier family 38 member 2; System A amino acid transporter; System A amino acid transporter 2; System A transporter 1; System N amino acid transporter 2
-
Species
Human
-
Source
E. coli
-
Tag
N-His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96QD8
-
Expression Region
239-292aa
-
AA Sequence
KKFQVPCPVEAALIINETINTTLTQPTALVPALSHNVTENDSCRPHYFIFNSQT
-
Molecular Weight
10kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Identification
Protein Description
SLC38A2, a member of the SLC38 family of solute carriers, is primarily known for its role as a sodium-coupled transporter of neutral amino acids across cellular membranes. Research into SLC38A2 has gained momentum due to its implications in various physiological processes, including neurotransmission and metabolic regulation. Mutations in the SLC38A2 gene are associated with neurodevelopmental disorders, notably intellectual disability and autism spectrum disorders, indicating the transporter's critical role in brain function and development. The study of recombinant SLC38A2 protein provides insights into its structure-function relationship, substrate specificity, and transport mechanisms, which are essential for understanding its physiological relevance and potential pathophysiological roles. By producing and characterizing this recombinant protein, researchers aim to elucidate the transport kinetics and regulatory mechanisms underlying amino acid homeostasis, thereby contributing to the understanding of related metabolic disorders and guiding therapeutic strategies. This research not only enhances our comprehension of SLC38A2's biological functions but also holds promise for the development of targeted interventions for conditions linked to its dysregulation.











