Recombinant Human CD131 Protein(HEK293) , hFc

CD131

The EPOR Protein functions as a receptor for erythropoietin, mediating erythroblast proliferation and differentiation upon EPO stimulation. The heterodimer triggers the JAK2/STAT5 signaling cascade and, in certain cell types, activates STAT1, STAT3, and the LYN tyrosine kinase. Additionally, isoform EPOR-T acts as a dominant-negative receptor, modulating EPOR-mediated signaling pathways. EPOR-CD131 Heterodimer Protein, Human (HEK293, Fc) is a recombinant protein dimer complex containing human-derived EPOR-CD131 Heterodimer protein, expressed by HEK293 , with C-hFc labeled tag. EPOR-CD131 Heterodimer Protein, Human (HEK293, Fc), has molecular weight of ~110-130 kDa.

SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

Measured by its binding ability in a functional ELISA. Immobilized Human EPOR at 2μg/mL (100μL/well) can bind biotinylated EPO. The ED50 for this effect is 44.91ng/mL. Measured by its binding ability in a functional ELISA. Immobilized Human EPOR at 2 μg/mL (100 μL/well) can bind biotinylated EPO. The ED50 for this effect is 44.91 ng/mL.

EpoR; EPO-R; Erythropoietin R; Erythropoietin receptor

Human

HEK293

C-hFc

Greater than 95% as determined by reducing SDS-PAGE.

P19235 (A25-P250)&P32927

P19235 (A25-P250)&P32927 (W17-W443)

MDHLGASLWPQVGSLCLLLAGAAWAPPPNLPDPKFESKAALLAARGPEELLCFTERLEDLVCFWEEAASAGVGPGNYSFSYQLEDEPWKLCRLHQAPTARGAVRFWCSLPTADTSSFVPLELRVTAASGAPRYHRVIHINEVVLLDAPVGLVARLADESGHVVLRWLPPPETPMTSHIRYEVDVSAGNGAGSVQRVEILEGRTECVLSNLRGRTRYTFAVRARMAEPSFGGFWSAWSEPVSLLTPSDLDP&WERSLAGAEETIPLQTLRCYNDYTSHITCRWADTQDAQRLVNVTLIRRVNEDLLEPVSCDLSDDMPWSACPHPRCVPRRCVIPCQSFVVTDVDYFSFQPDRPLGTRLTVTLTQHVQPPEPRDLQISTDQDHFLLTWSVALGSPQSHWLSPGDLEFEVVYKRLQDSWEDAAILLSNTSQATLGPEHLMPSSTYVARVRTRLAPGSRLSGRPSKWSPEVCWDSQPGDEAQPQNLECFFDGAAVLSCSWEVRKEVASSVSFGLFYKPSPDAGEEECSPVLREGLGSLHTRHHCQIPVPDPATHGQYIVSVQPRRAEKHIKSSVNIQMAPPSLNVTKDGDSYSLRWETMKMRYEHIDHTFEIQYRKDTATWKDSKTETLQNAHSMALPALEPSTRYWARVRVRTSRTGYNGIWSEWSEARSWDTESVLPMW

110-130 kDa

< 1.0 EU per μg protein as determined by the LAL method.

Freeze-dried powder

PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.