Cat: IPD-X16916

Recombinant Rat P-Selectin Protein(HEK293) , His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    P-Selectin

  • 简介

    P-Selectin, a Ca(2+)-dependent receptor on myeloid cells, binds to neutrophils and monocytes via carbohydrates. It interacts with SELPLG to enable rapid leukocyte rolling over vascular surfaces in early inflammation. P-Selectin also interacts with SNX17 and promotes neutrophil adhesion and rolling, requiring SELPLG's sialyl-Lewis X and tyrosine sulfation. P-Selectin Protein, Rat (HEK293, His) is the recombinant rat-derived P-Selectin protein, expressed by HEK293 , with C-His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    P-selectin; GMP-140; LECAM3; PADGEM; CD62P; Selp

  • Species

    Rat

  • Source

    HEK293

  • Tag

    C-10*His

  • Purity

    Greater than 95% as determined by reducing SDS-PAGE.

  • Uniprot

    P98106

  • Expression Region

    W42-Q700

  • AA Sequence

    WTYNYSTKAYSWNNSRAFCKRHFTDLVAIQNKNEIAHLNDVIPYVNSYYWIGIRKINNKWTWVGTNKTLTAEAENWADNEPNNKRNNQDCVEIYIKSNSAPGKWNDEPCFKRKRALCYTASCQDMSCNSQGERIETIGSYTCSCYPGFYGPECEYVQECGKFDIPQHVLMNCSHPLGDFSFSSQCTFSCPEGYDLNGPSEMQCLASGIWTNNPPQCKAVQCQSLEAPLHGTMDCTHPLAAFAYDSSCKFECQPGYRMRGSDILHCTDSGQWSEPLPTCEAIACEPLESPLHGSMDCFPSTGAFGYNSSCTFRCTEGFVLMGNDAIHCADLGQWTAPAPVCEALQCQEFPVPSKAQVSCSDPFGPLKYQSACSFSCDEGSLLVGASVIRCLATGHWSEAPPECQAVSCTPLLSPENGTMTCIQPLGHSNYKSTCQFMCDEGFYLSGPERLDCSPSGHWTGSPPMCEAIKCPEIFAPEQGSLDCSHVHGEFSVGSTCHFSCNEEFELLGSRNVECTVSGRWSAPPPTCKGVTSLPVPSVRCPALTTPGQGTMSCRHHLESFGPNTTCYFGCKTGFTLRGANSLRCGASGQWTAVTPVCRAVKCSELHMDTAVAMNCSNPWGNFSYGSTCAFHCPEGQSLNGSARTTCGEDGHWSDAMPTCQ

  • Protein Length

    Partial

  • Molecular Weight

    115 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

P-selectin, a member of the selectin family of cell adhesion molecules, plays a critical role in the immune response and inflammation by mediating the rolling of leukocytes along the endothelium. This glycoprotein is expressed on the surface of activated endothelial cells and platelets, facilitating the recruitment of immune cells to sites of injury or infection. Understanding the function and mechanisms of P-selectin is essential for developing therapeutic strategies for various inflammatory diseases, cardiovascular disorders, and cancer metastasis. Research on recombinant P-selectin proteins has emerged as a valuable tool for elucidating these mechanisms. By producing P-selectin in a recombinant form, scientists can study its binding interactions, structure, and role in cell adhesion more effectively. This advance allows for the potential development of P-selectin inhibitors that could be used to modulate immune responses or treat diseases characterized by excessive inflammation. The recombinant protein can also serve as a platform for studying the effects of post-translational modifications and for screening drug candidates that target P-selectin. Overall, the exploration of P-selectin recombinant proteins represents an important avenue in the field of immunology and therapeutic development, with implications for improving patient outcomes in inflammatory and malignant conditions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US