Analytical Data
-
Gene name
IL-3R alpha/CD123
-
简介
IL-3R α/CD123 protein is an important member of the type I cytokine receptor family and mediates cellular responses to a variety of cytokines, emphasizing its key role in hematopoiesis and immune regulation.IL-3R alpha/CD123 Protein, Canine (HEK293, His) is the recombinant canine-derived IL-3R alpha/CD123 protein, expressed by HEK293 , with C-6*His labeled tag.
- Application
-
Biological Activity
Immobilized IL-3Rα at 1 μg/mL (100 μL/well) can bind Biotinylated IL-3 protein. The ED50 for this effect is 44.84 ng/mL, corresponding to a specific activity is 2.23×10^4 Unit/mg. Measured in a cell proliferation assay using A549 cells. The ED50 for this effect is 3.586 ng/mL, corresponding to a specific activity is 2.79×105 units/mg.
-
Alternative Names
IL3R; IL3RA; IL-3Ra; IL-3R-alpha; IL3RAY; IL3RX; IL3RY; CD123 antigen; CD123; hIL3Ra; hIL-3Ra; MGC34174; IL-3 R alpha
-
Species
Canine
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 95% as determined by reducing SDS-PAGE.
-
Uniprot
XP_038305195.1
-
Expression Region
S33-D315
-
AA Sequence
SEKDPDSPIKNLRMEPGSRRLTWDLSGNVSEIKCFINSKYITKAIDSRYCQFYVLPLCEVKNFTISVKQDPPFSTGLQYVPRGAEGKPAAAARGLDCWVHDVDFLTCSWEVGRAAPGDVQYRLYWRDLKAYREQECPRYEANNRGVHVRCRFDDVSRLQRHIQFWVNGTSRRSGIPCSDLCVELPEIERLSPPHITATCNKSYSMMEWKVLSHFNHRFLYELQIQKGTDPASTEKLYENHFVIYNPGNYVAKLKVQGFFRKDWSEWSAPQLFVCDPKDEHRRD
-
Protein Length
Partial
-
Molecular Weight
42-50 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Interleukin-3 receptor alpha (IL-3Rα), also known as CD123, is a crucial component of the IL-3 receptor complex, which plays a significant role in hematopoiesis and immune regulation. Expressed on various hematopoietic cells, including stem cells and progenitor cells, IL-3Rα facilitates the binding of interleukin-3 (IL-3), a key cytokine that promotes cell proliferation, survival, and differentiation. Increased expression of CD123 has been observed in several hematological malignancies, such as acute myeloid leukemia (AML) and other leukemias, making it an attractive target for therapeutic interventions. The development of recombinant IL-3Rα/CD123 proteins holds promise for enabling new strategies in cancer treatment, particularly through targeted therapies such as monoclonal antibodies and chimeric antigen receptor (CAR) T-cell therapies. Research focusing on the structural and functional characterization of IL-3Rα/CD123 recombinant protein seeks to enhance understanding of its role in cellular signaling and to identify potential therapeutic targets. Additionally, the generation of high-purity recombinant proteins can facilitate the development of diagnostic tools and treatment options that could improve patient outcomes in diseases associated with aberrant IL-3 signaling. Investigating the molecular interactions and pathways involving IL-3Rα will contribute further to the field of immunotherapy and potentially lead to novel interventions for hematological cancers and other disorders linked to IL-3 dysregulation.











