Analytical Data
-
Gene name
Nectin-2/CD112
-
简介
Nectin-2, a poliovirus receptor-related 2 protein, is a type I transmembrane glycoprotein and a member of the Ig gene superfamily. Nectin-2, also known as CD112, is an adhesion molecule involved in the formation of cell junctions and interactions with other Nectin-family molecules. Nectin-2/CD112 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived Nectin-2/CD112 protein, expressed by HEK293 , with C-His labeled tag.
- Application
-
Biological Activity
Measured by its binding ability in a functional ELISA. When Recombinant Cynomolgus Nectin-2/CD112 is immobilized at 0.5 µg/mL (100 µL/well), Recombinant Cynomolgus DNAM-1/CD226 binds with an ED50 of 0.5776 μg/mL. Measured by its binding ability in a functional ELISA. When Recombinant Cynomolgus Nectin-2/CD112 is immobilized at 0.5 µg/mL (100 µL/well), Recombinant Cynomolgus DNAM-1/CD226 binds with an ED50 of 0.5776 μg/mL.
-
Alternative Names
Nectin-2; CD112; NECTIN2; PVRL2; HVEB; PRR2
-
Species
Cynomolgus
-
Source
HEK293
-
Tag
C-His
-
Purity
Greater than 95% as determined by reducing SDS-PAGE.
-
Uniprot
Q0MSE5
-
Expression Region
Q32-L360
-
AA Sequence
QDVRVQVLPEVRGQLGGTVELPCHLLPPVPGLYISLVTWQRPDAPPDHQNVAAFHPKMGPSFPSPKPGSERLSFVSAKQSTRQDTEAELQDATLALRGLTVEDEGNYTCEFATFPKGSVRGMTWLRVIAKPQNHAEAQEVTFSQDPVPVARCISKEGRPPARISWLSSLDWEAKETQVSGTLAGTVTVTSRFTLVPSGRADGVTVTCKVEHESFEEPALIPVTLSVRYPPEVSISGYDDNWYLGRTDATLSCDVHSNPEPTGYDWSTTSGIFPTSAVAQGSQLVIHAVDSLFNTTFVCTVTNAVGMGRAEQVIFVRETPRASPRDMGPL
-
Protein Length
Partial
-
Molecular Weight
47 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Nectin-2, also known as CD112, is a member of the Nectin family, which comprises immunoglobulin-like cell adhesion molecules. It plays a crucial role in cellular interactions, including cell adhesion and migration, and is involved in various physiological and pathological processes, such as immune response and tumor progression. The expression of Nectin-2 has been observed in multiple types of tumors, where it facilitates immune evasion by interacting with the DNAM-1 receptor on natural killer (NK) cells and T cells, thereby inhibiting their cytotoxic functions. Consequently, Nectin-2 has garnered attention as a potential target for cancer immunotherapy. Researchers are focused on the development of recombinant Nectin-2/CD112 proteins to better understand its biological functions and to create therapeutic strategies that can block its immunosuppressive effects. These recombinant proteins can also be utilized in the study of Nectin-2's role in tumor biology, as well as in the development of Nectin-2-targeted therapies, such as monoclonal antibodies or fusion proteins. By elucidating the mechanisms by which Nectin-2 modulates immune responses, scientists aim to enhance the effectiveness of cancer immunotherapies and improve patient outcomes.
