Analytical Data
-
Gene name
RANKL/TNFSF11
-
简介
RANKL (TNFSF11), a type II transmembrane protein, is a receptor activator of NF-κB (RANK) ligand. RANKL is an activator of RANK. When binding to RANK, it induces the differentiation of monocyte/macrophage-lineage cells into osteoclasts and leads to osteoclast precursor maturation. RANKL is critical for osteoclasts maturation, bone modeling, and bone remodeling, as well as the development of lymph nodes (LNs). RANKL/TNFSF11 Protein, Human (HEK293) is a recombinant human RANKL (G64-D245) without any tag, which is produced in HEK293 cell[1][2].
- Application
-
Biological Activity
1.Immobilized human TNFSF11 at 2 μg/mL (100 μL/well) can bind human Osteoprotegerin-hFc and the EC50 is 5-40 ng/mL. 2. Measured by its ability to induce TRAP activity, inducing osteoclast differentiation of RAW 264.7 mouse monocyte/macrophage cells. The ED50 for this effect is 1.5-19.69 ng/mL, corresponding to a specific activity is > 5.079×10^4 units/mg. 3. Loaded Narlumosbart (HY-P99966) on AHC2 biosensor, can bind RANKL/TNFSF11 Protein, Human (HEK293) with an affinity constant of <1.000E-11 M as determined in BLI assay. Measured by its ability to induce osteoclast differentiation of RAW 264.7 mouse monocyte/macrophage cells. The ED50 for this effect is 19.69 ng/mL, corresponding to a specific activity is 5.079×104 units/mg. Loaded Narlumosbart (HY-P99966) on AHC2 biosensor, can bind RANKL/TNFSF11 Protein, Human (HEK293) with an affinity constant of <1.000E-11 M as determined in BLI assay.
-
Alternative Names
Tumor necrosis factor ligand superfamily member 11; RANKL; CD254; ODF; OPGL; TNFSF11; TRANCE
-
Species
Human
-
Source
HEK293
-
Tag
Tag Free
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
AAC51762.1
-
Expression Region
G64-D245
-
AA Sequence
GSQHIRAEKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSHKVSLSSWYHDRGWGKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDID
-
Protein Length
Partial
-
Molecular Weight
28.81 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RANKL (Receptor Activator of Nuclear Factor κB Ligand), also known as TNFSF11 (Tumor Necrosis Factor Superfamily Member 11), plays a crucial role in bone metabolism and immune response. It is a cytokine that primarily regulates osteoclastogenesis—the process by which bone-resorbing osteoclasts are formed from precursor cells. The interaction of RANKL with its receptor RANK, found on osteoclast precursors, is fundamental for the differentiation, activation, and survival of osteoclasts, which are essential for bone remodeling. Dysregulation of the RANKL/RANK signaling pathway is implicated in various bone diseases, such as osteoporosis, rheumatoid arthritis, and bone metastasis. Research on recombinant RANKL protein has gained prominence as it provides vital insights into the molecular mechanisms of osteoclastogenesis and offers potential therapeutic avenues for treating bone-related disorders. Additionally, recombinant RANKL is used in in vitro studies to generate osteoclasts for research purposes, enhancing our understanding of bone biology and the pathophysiology of osteoclast-mediated diseases. The study of RANKL/TNFSF11 recombinant proteins could lead to innovative treatments that target RANKL signaling, potentially ameliorating conditions characterized by excessive bone loss or insufficient bone remodeling. As research progresses, elucidating the structure-function relationships, regulatory mechanisms, and therapeutic implications of RANKL will be pivotal in developing effective strategies for managing bone-related illnesses and improving patient outcomes.











