Analytical Data
-
Gene name
CRTAM/CD355
- Application
-
Alternative Names
rCynCRTAM, His; Cytotoxic and Regulatory T-Cell Molecule; Class-I MHC-Restricted T-Cell-Associated Molecule; CD355; CRTAM
-
Species
Cynomolgus
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
XP_005580021.1
-
Expression Region
S18-G287
-
AA Sequence
SLTNHTETITVEEGQTLTLKCVTSLRKSSSLQWLTPSGFTIFLNEYPAFKNSRYQLLHHSANQLSISVSNITLQDEGVYKCLHYSDSVSTKEVKVIVLATPFKPILEASVIRKQNGEEHVVLMCSAMRSKPPPQITWLLGNGVEVSGGTHHEFETDGKKCNTTSTLIIHTYGKNSTVDCIIRHRGLQGRKLVAPFRFEDLVTDEETASDALERNSVSSQDPQQPTSTVSVMEDSSTLEIDKEEKEQTTQDPDLTTKANPQYLGLARKKSG
-
Protein Length
Partial
-
Molecular Weight
50-60 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CRTAM (Cytotoxic T lymphocyte-associated protein 4 receptor) is a crucial immune regulatory protein that plays a significant role in T cell-mediated immune responses, particularly in the context of cancer and viral infections. CD355, another designation for CRTAM, is predominantly expressed on activated T cells and is involved in promoting T cell interactions with various immune cells, thereby enhancing immune activation and cytotoxicity. Research into CRTAM/CD355 recombinant proteins aims to elucidate their structure-function relationships, signaling pathways, and potential therapeutic applications in immunotherapy. The unique properties of CRTAM suggest that it may serve as a promising target for enhancing anti-tumor immunity. Furthermore, understanding the molecular mechanisms by which CRTAM/CD355 influences T cell behavior can provide vital insights into how to manipulate immune responses for improved therapeutic outcomes. Studies focusing on the generation of recombinant CRTAM/CD355 proteins will contribute to the development of innovative strategies for cancer treatment and vaccination approaches against chronic infections, underlining the importance of this research in the field of immunology and therapeutic development.











