Cat: IPD-X19017

Recombinant Mouse CD105/Endoglin Protein(HEK293), His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CD105/Endoglin

  • 简介

    CD105/Endoglin is an important endothelial glycoprotein that controls angiogenesis and ensures the structural integrity of the adult vasculature. It affects vascular endothelial cell migration and has important implications for extraembryonic and embryonic heart development. CD105/Endoglin Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD105/Endoglin protein, expressed by HEK293 , with C-His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Endoglin; END; CD105; ENG; Cell surface MJ7/18 antigen

  • Species

    Mouse

  • Source

    HEK293

  • Tag

    C-His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q63961

  • Expression Region

    R28-G581

  • AA Sequence

    MDRGVLPLPITLLFVIYSFVPTTGLAERVGCDLQPVDPTRGEVTFTTSQVSEGCVAQAANAVREVHVLFLDFPGMLSHLELTLQASKQNGTETQEVFLVLVSNKNVFVKFQAPEIPLHLAYDSSLVIFQGQPRVNITVLPSLTSRKQILDWAATKGAITSIAALDDPQSIVLQLGQDPKAPFLCLPEAHKDMGATLEWQPRAQTPVQSCRLEGVSGHKEAYILRILPGSEAGPRTVTVMMELSCTSGDAILILHGPPYVSWFIDINHSMQILTTGEYSVKIFPGSKVKGVELPDTPQGLIAEARKLNASIVTSFVELPLVSNVSLRASSCGGVFQTTPAPVVTTPPKDTCSPVLLMSLIQPKCGNQVMTLALNKKHVQTLQCTITGLTFWDSSCQAEDTDDHLVLSSAYSSCGMKVTAHVVSNEVIISFPSGSPPLRKKVQCIDMDSLSFQLGLYLSPHFLQASNTIELGQQAFVQVSVSPLTSEVTVQLDSCHLDLGPEGDMVELIQSRTAKGSCVTLLSPSPEGDPRFSFLLRVYMVPTPTAGTLSCNLALRPSTLSQEVYKTVSMRLNIVSPDLSGKG

  • Protein Length

    Extracellular Domain

  • Molecular Weight

    65-70 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CD105, also known as endoglin, is a type I transmembrane protein and a co-receptor for transforming growth factor-beta (TGF-β), playing a crucial role in angiogenesis and vascular remodeling. It is primarily expressed on the surface of endothelial cells and is implicated in various physiological and pathological processes, including wound healing, tumor progression, and inflammatory responses. The significance of CD105 in these processes has led researchers to investigate its potential as a therapeutic target and a biomarker for several diseases, such as cancer and vascular disorders. The recombinant protein of CD105 is utilized in various research applications to better understand its biological functions and interactions within cellular pathways. Studies have shown that modulation of CD105 expression affects endothelial cell proliferation, migration, and tube formation, highlighting its importance in angiogenesis. Furthermore, CD105 has been identified as a promising target for targeted drug delivery and immunotherapy, given its restricted expression on activated endothelial cells in tumors. As such, ongoing research focuses on characterizing CD105/Endoglin recombinant proteins for their potential use in diagnostic and therapeutic strategies, paving the way for advancements in precision medicine and targeted cancer therapies. Understanding the molecular mechanisms of CD105 can provide insights into novel therapeutic approaches, enhancing the effectiveness of treatments for various diseases characterized by aberrant angiogenesis and vascular dysfunction.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US