Analytical Data
-
Gene name
BTNL4
- Application
-
Alternative Names
rMuButyrophilin, subfamily 3, member A3/BTNL4, His; BTN3A3; BTNL4; EG632126; NG11
-
Species
Mouse
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
A2CG29
-
Expression Region
Q29-W250
-
AA Sequence
QEFRVFGPSDPIVAAPGGEAILPCSVFPAMNVENMEELRWFRSRFSEAVLFYRDQEEQKEGQMPGYSQRTLLVKDQFHQGTAAVRILNVQASDSGIYICHFQQGVFYDEAILELKVAAMGSVPEVHIKGPEDGGVCVVCMTSGWYPEPQVHWKDSRGENLTAFSSETHTKDAEGLFSTETLLVVRDSSVRNVTCSIFNPILGQEKATAMFIPEPFFPQASPW
-
Protein Length
Partial
-
Molecular Weight
30-40 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
BTNL4 (Butyrophilin-like 4) is a member of the butyrophilin family, which plays a crucial role in immune regulation and T cell activation. Recent studies have highlighted its potential as a key player in autoimmune diseases and infections, as it is involved in modulating the immune response. The importance of BTNL4 in maintaining immune homeostasis and its differential expression in various tissues have sparked interest in its molecular function and biological significance. Researchers have recognized that the recombinant expression of BTNL4 can provide insights into its structure-function relationship, facilitate the investigation of its interaction with T cell receptors, and offer potential therapeutic applications. Recombinant BTNL4 has been produced to study its role in the modulation of the immune response, particularly in the context of chronic inflammatory diseases. Understanding the immunological mechanisms mediated by BTNL4 could lead to novel strategies for manipulating immune responses in clinical settings, particularly for designing new vaccines or immunotherapies. The ongoing research aims to elucidate the specific pathways influenced by BTNL4 and its potential as a biomarker for disease progression or therapeutic efficacy. This line of investigation is critical as it may pave the way for innovative approaches to treat conditions where the immune system is dysregulated.
