Analytical Data
-
Gene name
Basigin/CD147
-
简介
The Basigin/CD147 protein is essential for retinal maturation and development, acting as a NXNL1 receptor to promote the survival of retinal cone photoreceptor cells. Basigin/CD147 Protein, Mouse (304a.a, HEK293, His) is the recombinant mouse-derived Basigin/CD147 protein, expressed by HEK293 , with C-6*His labeled tag.
- Application
-
Alternative Names
Basigin; BSG; 5F7; CD147; EMMPRIN; M6; OK; TCSF
-
Species
Mouse
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P18572-1
-
Expression Region
A22-R325
-
AA Sequence
AAGFLKAPLSQERWAGGSVVLHCEAVGSPIPEIQWWFEGNAPNDSCSQLWDGARLDRVHIHAAYRQHAASSLSVDGLTAEDTGTYECRASSDPDRNHLTRPPRVKWVRAQASVVVLEPGTIQTSVQEVNSKTQLTCSLNSSGVDIVGHRWMRGGKVLQEDTLPDLHTKYIVDADDRSGEYSCIFLPEPVGRSEINVEGPPRIKVGKKSEHSSEGELAKLVCKSDASYPPITDWFWFKTSDTGEEEAITNSTEANGKYVVVSTPEKSQLTISNLDVNVDPGTYVCNATNAQGTTRETISLRVRSR
-
Protein Length
Extracellular Domain
-
Molecular Weight
45-65 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Basigin, also known as CD147, is a transmembrane glycoprotein belonging to the immunoglobulin superfamily, playing critical roles in various physiological and pathological processes. Initially identified as an important factor in sperm-egg fusion, Basigin has since been implicated in numerous biological functions, including cell adhesion, immune response modulation, and angiogenesis. It serves as a receptor for the enzyme matrix metalloproteinases (MMPs), influencing extracellular matrix remodeling, which is crucial in cancer metastasis and tissue repair. Given its diverse roles, Basigin has garnered attention as a potential therapeutic target in various diseases, including cancer, autoimmune disorders, and infectious diseases. Research has focused on the development of recombinant Basigin/CD147 proteins to better understand its complex functions and interactions at a molecular level. These recombinant proteins facilitate detailed studies on Basigin's receptor activities, structural characteristics, and signaling pathways. Additionally, they hold promise for use in drug development and biomarker identification, particularly in cancer diagnostics and treatment strategies. The exploration of Basigin/CD147 continues to illuminate its potential as a multifunctional player in health and disease, making it a significant focus in biomedical research.











