Analytical Data
-
Gene name
MGL2/CD301b
-
简介
MGL2/CD301b is a type II lectin commonly used as a marker for alternatively activated macrophages. MGL2 can bind to terminal GalNAc residues, including the Tn antigen (GalNAc-αThr/Ser). MGL2 is mainly expressed on immature, tolerogenic or type-2 DCs and alternatively-activated macrophages[1][2]. MGL2/CD301b Protein, Mouse (HEK293, His) is the recombinant mouse-derived MGL2/CD301b protein, expressed by HEK293 , with N-6*His labeled tag.
- Application
-
Alternative Names
Mgl2; CD301b; Macrophage galactose N-acetyl-galactosamine-specific lectin 2; Macrophage Galactose-type C-lectin 2
-
Species
Mouse
-
Source
HEK293
-
Tag
N-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8JZN1
-
Expression Region
S72-P332
-
AA Sequence
SQNSQLRRDLGTLRAILDNTTSKIKAEFQSLDSRADNFEKGISSLKVDVEDHRQELQAGRDLSQKVTSLESTLEKREQALKTDLSDLTDHVQQLETDLKALTCQLANLKNNGSEVACCPLHWTEHEGSCYWFSESEKSWPEADKYCRLENSHLVVVNSLEEQNFLQNRLANVLSWMGLTDQNGPWRWVDGTDFDKGFKNWRPLQPDNWHGHMLGGGEDCAHFSYDGRWNDDVCQRHYHWICETELGKASSAHSPQLIASVP
-
Protein Length
Cytoplasmic Domain
-
Molecular Weight
30-40 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MGL2 (Macrophage Galactose-type C-type Lectin 2), also known as CD301b, is a member of the C-type lectin receptor family and plays a critical role in the immune response and homeostasis. This receptor is predominantly expressed on macrophages and dendritic cells and has been shown to recognize specific carbohydrate structures, particularly galactose and N-acetylgalactosamine residues, which are often found on glycoproteins and glycolipids. The study of recombinant MGL2/CD301b protein is significant for several reasons. First, elucidating its structure and function can enhance our understanding of its role in pathogen recognition and clearance, particularly in the context of microbial infections and cancer. Additionally, MGL2/CD301b has been implicated in modulating immune responses, including promoting T-helper 2 cell responses and facilitating antigen presentation. Moreover, targeting MGL2/CD301b may offer new therapeutic avenues for diseases characterized by an imbalanced immune response, such as allergies or autoimmune disorders. By generating recombinant MGL2/CD301b protein, researchers can investigate its binding affinities to various ligands, assess its signaling pathways, and explore its potential as a target for immunotherapeutic strategies. Overall, the research surrounding MGL2/CD301b recombinant protein is poised to contribute significantly to the fields of immunology and therapeutic development.
