Cat: IPD-X19296

Recombinant Mouse ART4/CD297 Protein(HEK293), His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ART4/CD297

  • 简介

    ART4/CD297 Protein , a protein that contains a mono-ADP-ribosylation (ART) motif, is involved in peptidyl-arginine ADP-ribosylation. It is a member of the ADP-ribosyltransferase gene family. ART4 is expressed in several structures, including cardiovascular system, genitourinary system, integumental system, liver; and sensory organ. In addition, ART4 plays an important role in erythrocyte invasion by P. falciparum. ART4/CD297 Protein, Mouse (HEK293, His) is the recombinant mouse-derived ART4/CD297 protein, expressed by HEK293 , with C-His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Ecto-ADP-ribosyltransferase 4; ARTC4; Mono(ADP-ribosyl)transferase 4; DO; DOK1

  • Species

    Mouse

  • Source

    HEK293

  • Tag

    C-6*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9CRA0

  • Expression Region

    G24-K263

  • AA Sequence

    GSTEAPLKVDVDLTPDSFDDQYQGCSEQMVEELNQGDYFIKEVDTHKYYSRAWQKAHLTWLNQAKALPESMTPVHAVAIVVFTLNLNVSSDLAKAMARAAGSPGQYSQSFHFKYLHYYLTSAIQLLRKDSSTKNGSLCYKVYHGMKDVSIGANVGSTIRFGQFLSASLLKEETRVSGNQTLFTIFTCLGASVQDFSLRKEVLIPPYELFEVVSKSGSPKGDLINLRSAGNMSTYNCQLLK

  • Protein Length

    Full Length of ART4

  • Molecular Weight

    38-45 kDa.

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The ART4/CD297 protein, a member of the CD family of receptors, has garnered attention in recent years due to its pivotal role in immune system regulation and cell signaling. Emerging research indicates that ART4 functions as a nucleotide sugar transporter, participating in the biosynthesis of glycoproteins and glycolipids that are crucial for cellular communication and immune responses. Its expression is primarily observed in immune cells, such as lymphocytes, where it may influence T cell activity and differentiation. Abnormalities in ART4/CD297 expression have been linked to various immunological diseases, including autoimmune disorders and malignancies. For these reasons, understanding the structure and function of ART4/CD297 can provide valuable insights into its potential as a therapeutic target. Researchers are exploring the possibilities of using recombinant ART4/CD297 proteins to elucidate its signaling pathways, interactions with other cell surface receptors, and its overall impact on immune responses. Insights gained from these studies may pave the way for novel immunotherapeutic strategies, contributing to the development of treatments for disorders characterized by immune dysregulation.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US