Analytical Data
-
Gene name
LILRB4/CD85k/ILT3
-
简介
The LILRB4/CD85k/ILT3 protein is a multifaceted inhibitory receptor in immune regulation that significantly downregulates multiple immune responses. As a receptor for FN1 and integrin ITGAV/ITGB3, LILRB4/ILT3 inhibits IgE-mediated mast cell activation, KITLG/SCF-mediated mast cell activation, and antibody production by memory/marginal zone B cells through the ITGAV/ITGB3 interaction. LILRB4/CD85k/ILT3 Protein, Mouse (HEK293, His) is the recombinant mouse-derived LILRB4/CD85k/ILT3 protein, expressed by HEK293 , with C-6*His labeled tag.
- Application
-
Alternative Names
Leukocyte immunoglobulin-like receptor subfamily B member 4; CD85k; Lilrb4; Gp49b
-
Species
Mouse
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q64281
-
Expression Region
G24-K238
-
AA Sequence
GHLPKPIIWAEPGSVIAAYTSVITWCQGSWEAQYYHLYKEKSVNPWDTQVPLETRNKAKFNIPSMTTSYAGIYKCYYESAAGFSEHSDAMELVMTGAYENPSLSVYPSSNVTSGVSISFSCSSSIVFGRFILIQEGKHGLSWTLDSQHQANQPSYATFVLDAVTPNHNGTFRCYGYFRNEPQVWSKPSNSLDLMISETKDQSSTPTEDGLETYQK
-
Protein Length
Extracellular Domain
-
Molecular Weight
35-40 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
LILRB4, also known as CD85k or ILT3 (Immunoglobulin-like transcript 3), is a member of the leukocyte immunoglobulin-like receptor (LILR) family, which plays a crucial role in regulating immune responses. This receptor is predominantly expressed on myeloid cells, including dendritic cells and macrophages, and is involved in inhibitory signaling pathways that modulate T cell activation and maintain immune tolerance. Its significance has been underscored in various studies linking LILRB4 to processes such as tumor immune evasion, autoimmune diseases, and chronic infections. The expression of LILRB4 on tumor-associated macrophages facilitates the suppression of anti-tumor immunity, making it a subject of interest in cancer immunotherapy. Additionally, recombinant LILRB4/CD85k/ILT3 proteins have been developed for research purposes to better understand their structural and functional properties, as well as their interactions with ligands. Investigating the role of this receptor can provide insights into novel therapeutic targets for modulating immune responses and enhancing the efficacy of immunotherapies. Understanding the mechanisms through which LILRB4 operates not only aids in deciphering its biological functions but also paves the way for novel approaches to address immune-related disorders.











