Analytical Data
-
Gene name
PPARD
-
简介
PPARD protein is a ligand-activated transcription factor that critically mediates energy metabolism in adipose tissue. As a receptor, it selectively binds peroxisome proliferators, including hypolipidemic drugs and fatty acids, and preferentially binds polyunsaturated substances. PPARD Protein, Human (HEK293, His) is the recombinant human-derived PPARD protein, expressed by HEK293, with C-6*His labeled tag.
- Application
-
Alternative Names
Peroxisome proliferator-activated receptor delta; PPAR-delta; NUCI; Nuclear hormone receptor 1 (NUC1); Nuclear receptor subfamily 1 group C member 2; Peroxisome proliferator-activated receptor beta (PPAR-beta);
-
Species
Human
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q03181-1
-
Expression Region
M1-Y441
-
AA Sequence
MEQPQEEAPEVREEEEKEEVAEAEGAPELNGGPQHALPSSSYTDLSRSSSPPSLLDQLQMGCDGASCGSLNMECRVCGDKASGFHYGVHACEGCKGFFRRTIRMKLEYEKCERSCKIQKKNRNKCQYCRFQKCLALGMSHNAIRFGRMPEAEKRKLVAGLTANEGSQYNPQVADLKAFSKHIYNAYLKNFNMTKKKARSILTGKASHTAPFVIHDIETLWQAEKGLVWKQLVNGLPPYKEISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNKDGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGDRPGLMNVPRVEAIQDTILRALEFHLQANHPDAQYLFPKLLQKMADLRQLVTEHAQMMQRIKKTETETSLHPLLQEIYKDMY
-
Protein Length
Full Length of Isoform-1
-
Molecular Weight
56-65 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PPARD, or Peroxisome Proliferator-Activated Receptor Delta, is a member of the nuclear receptor superfamily that plays a crucial role in regulating various physiological processes, including lipid metabolism, glucose homeostasis, and inflammation. Research on PPARD has gained significant attention due to its potential implications in metabolic disorders, cardiovascular diseases, and cancer. The protein functions as a transcription factor, modulating gene expression in response to fatty acids and other ligands, thereby influencing metabolic pathways. Studies have shown that PPARD activation can enhance fatty acid oxidation, improve insulin sensitivity, and reduce inflammation, making it an attractive therapeutic target for obesity and type 2 diabetes. Additionally, PPARD is implicated in muscle differentiation and endurance exercise adaptations, underscoring its importance in energy metabolism and physical performance. Advances in recombinant protein technology have facilitated the production of PPARD and its variants, enabling detailed structural and functional studies. These studies aim to elucidate the molecular mechanisms by which PPARD exerts its effects and to identify potential pharmacological agents that can selectively modulate its activity. Understanding the biological role of PPARD and its pathways is essential for developing targeted therapies that harness its beneficial effects while minimizing adverse outcomes, thus offering hope for innovative treatments in metabolic and inflammatory diseases.
