Cat: IPD-X35536

Recombinant Human PPARD Protein (HEK293),His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    PPARD

  • 简介

    PPARD protein is a ligand-activated transcription factor that critically mediates energy metabolism in adipose tissue. As a receptor, it selectively binds peroxisome proliferators, including hypolipidemic drugs and fatty acids, and preferentially binds polyunsaturated substances. PPARD Protein, Human (HEK293, His) is the recombinant human-derived PPARD protein, expressed by HEK293, with C-6*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Peroxisome proliferator-activated receptor delta; PPAR-delta; NUCI; Nuclear hormone receptor 1 (NUC1); Nuclear receptor subfamily 1 group C member 2; Peroxisome proliferator-activated receptor beta (PPAR-beta);

  • Species

    Human

  • Source

    HEK293

  • Tag

    C-6*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q03181-1

  • Expression Region

    M1-Y441

  • AA Sequence

    MEQPQEEAPEVREEEEKEEVAEAEGAPELNGGPQHALPSSSYTDLSRSSSPPSLLDQLQMGCDGASCGSLNMECRVCGDKASGFHYGVHACEGCKGFFRRTIRMKLEYEKCERSCKIQKKNRNKCQYCRFQKCLALGMSHNAIRFGRMPEAEKRKLVAGLTANEGSQYNPQVADLKAFSKHIYNAYLKNFNMTKKKARSILTGKASHTAPFVIHDIETLWQAEKGLVWKQLVNGLPPYKEISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNKDGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGDRPGLMNVPRVEAIQDTILRALEFHLQANHPDAQYLFPKLLQKMADLRQLVTEHAQMMQRIKKTETETSLHPLLQEIYKDMY

  • Protein Length

    Full Length of Isoform-1

  • Molecular Weight

    56-65 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

PPARD, or Peroxisome Proliferator-Activated Receptor Delta, is a member of the nuclear receptor superfamily that plays a crucial role in regulating various physiological processes, including lipid metabolism, glucose homeostasis, and inflammation. Research on PPARD has gained significant attention due to its potential implications in metabolic disorders, cardiovascular diseases, and cancer. The protein functions as a transcription factor, modulating gene expression in response to fatty acids and other ligands, thereby influencing metabolic pathways. Studies have shown that PPARD activation can enhance fatty acid oxidation, improve insulin sensitivity, and reduce inflammation, making it an attractive therapeutic target for obesity and type 2 diabetes. Additionally, PPARD is implicated in muscle differentiation and endurance exercise adaptations, underscoring its importance in energy metabolism and physical performance. Advances in recombinant protein technology have facilitated the production of PPARD and its variants, enabling detailed structural and functional studies. These studies aim to elucidate the molecular mechanisms by which PPARD exerts its effects and to identify potential pharmacological agents that can selectively modulate its activity. Understanding the biological role of PPARD and its pathways is essential for developing targeted therapies that harness its beneficial effects while minimizing adverse outcomes, thus offering hope for innovative treatments in metabolic and inflammatory diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US