Cat: IPD-X35550

Recombinant Human Androgen receptor Protein,His & SUMO

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Androgen receptor

  • 简介

    The androgen receptor protein is a steroid hormone receptor that acts as a ligand-activated transcription factor that regulates gene expression and affects cell proliferation and differentiation. Coactivators and corepressors such as ZBTB7A negatively regulate androgen receptor signaling by recruiting NCOR1 and NCOR2 to androgen response elements on target genes. Androgen receptor Protein, Human (His-SUMO, Myc) is the recombinant human-derived Androgen receptor protein, expressed by E. coli , with N-10*His, N-SUMO, C-Myc labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Biological Activity

    Measured by its ability to inhibit migration of PC-3 cells. The ED50 for this effect is 0.09167 μg/mL, corresponding to a specific activity is 1.091×10^4 U/mg. Measured by its ability to inhibit migration of PC-3 cells. The ED50 for this effect is 0.09167 μg/mL, corresponding to a specific activity is 1.091×10^4 U/mg.

  • Alternative Names

    AIS; ANDR_HUMAN; Androgen nuclear receptor variant 2; Androgen receptor dihydrotestosterone receptor; testicular feminization; SBMA; SMAX1; Testicular Feminization TFM; TFM

  • Species

    Human

  • Source

    E. coli

  • Tag

    N-10*His;N-SUMO;C-Myc

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P10275-1

  • Expression Region

    D551-T919

  • AA Sequence

    DYYFPPQKTCLICGDEASGCHYGALTCGSCKVFFKRAAEGKQKYLCASRNDCTIDKFRRKNCPSCRLRKCYEAGMTLGARKLKKLGNLKLQEEGEASSTTSPTEETTQKLTVSHIEGYECQPIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIACKRKNPTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFHT

  • Protein Length

    Partial

  • Molecular Weight

    58 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Androgen receptors (AR) play a crucial role in mediating the actions of androgens, which are key hormones in regulating various physiological processes, including male sexual development and maintenance of reproductive tissues. Dysregulation of AR signaling is implicated in numerous pathologies, such as prostate cancer, androgen insensitivity syndrome, and other hormone-related disorders. The study of AR recombinant proteins has gained significant attention as these proteins serve as essential tools for understanding AR structure, function, and signaling mechanisms at the molecular level. By producing recombinant AR proteins, researchers can investigate the effects of different ligands, including synthetic and natural hormones, and analyze the receptor's behavior in various biological contexts. Moreover, the ability to generate specific AR variants enables the study of mutations linked to disease and the development of potential therapeutic strategies. As such, understanding AR through recombinant protein studies provides invaluable insights into its role in health and disease, ultimately contributing to the advancement of targeted treatments for AR-related conditions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US