Analytical Data
-
Gene name
CD200R4
-
简介
The CD200R4 protein significantly contributes to TYROBP receptor recruitment or surface expression, suggesting its role in immune regulation or signaling processes. Molecular interactions with TYROBP underscore the function of CD200R4, which may influence downstream cellular responses and mediate TYROBP-related signaling events. CD200R4 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD200R4 protein, expressed by HEK293 , with C-His labeled tag.
- Application
-
Biological Activity
Measured by its binding ability in a functional ELISA. When Recombinant Mouse CD200 R4 is present at 0.5 μg/mL can bind Recombinant Mouse CD200. The ED50 for this effect is 1.23 μg/mL. Measured by its binding ability in a functional ELISA. When Recombinant Mouse CD200 R4 is present at 0.5 μg/mL can bind Recombinant Mouse CD200. The ED50 for this effect is 1.23 μg/mL.
-
Alternative Names
Cell surface glycoprotein CD200 receptor 4; CD200RLa; Cd200r4
-
Species
Mouse
-
Source
HEK293
-
Tag
C-His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6XJV4
-
Expression Region
T26-T241
-
AA Sequence
TDENQTIQNDSSSSLTQVNTTMSVQMDKKALLCCFSSPLINAVLITWIIKHRHLPSCTIAYNLDKKTNETSCLGRNITWASTPDHSPELQISAVALQHEGTYTCEIVTPEGNLEKVYDLQVLVPPEVTYFPGKNRTAVCEAMAGKPAAQISWTPDGDCVTKSESHSNGTVTVRSTCHWEQNNVSVVSCLVSHSTGNQSLSIELSQGTMTTPRSLLT
-
Protein Length
Extracellular Domain
-
Molecular Weight
The protein migrates as an 40-75 kDa band under reducing SDS-PAGE due to glycosylation.
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CD200R4 is a member of the CD200 receptor family, which plays a crucial role in regulating immune responses. It is primarily expressed on immune cells, including monocytes, macrophages, and dendritic cells, and is involved in the modulation of immune regulation and inflammation. The interaction between CD200 and its receptors, including CD200R4, is essential for maintaining the balance between immune activation and suppression, thereby playing a significant role in preventing autoimmune diseases and promoting tissue homeostasis. Recent studies have highlighted the potential therapeutic implications of targeting CD200R4 in various diseases, including chronic inflammatory conditions and cancers. Understanding the structure and function of CD200R4, particularly through the development of recombinant protein, can provide insights into its signaling mechanisms and interaction with ligands. The production of CD200R4 recombinant protein enables researchers to conduct functional assays and explore its potential as a biomarker or therapeutic target. Additionally, exploring the pathways regulated by CD200R4 may lead to the identification of novel strategies for enhancing immune response or dampening excessive inflammation in disease contexts. Given the complexities of the immune system, the continued study of CD200R4 could open new avenues for immunotherapy and contribute to the development of innovative treatments for a variety of immune-related disorders.
