Recombinant Human SLAMF6 Protein(HEK293), Avi & His

SLAMF6

SLAMF6 protein is an autoligand receptor in the SLAM family, which is critical for the activation and differentiation of immune cells and coordinates innate and adaptive immune responses. SLAMF6 is regulated by cytoplasmic adapters such as SH2D1A/SAP and/or SH2D1B/EAT-2, and can trigger the cytolytic activity of NK cells, including VAV1 phosphorylation and SH2D1B dependence. SLAMF6 Protein, Human (HEK293, His-Avi) is the recombinant human-derived SLAMF6 protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag.

SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

SLAM Family Member 6; Activating NK Receptor; NK-T-B-Antigen; NTB-A; CD352; SLAMF6; KALI

Human

HEK293

C-Avi;C-6*His

Greater than 90% as determined by SDS-PAGE.

Q96DU3-1

Q22-K225

QSSLTPLMVNGILGESVTLPLEFPAGEKVNFITWLFNETSLAFIVPHETKSPEIHVTNPKQGKRLNFTQSYSLQLSNLKMEDTGSYRAQISTKTSAKLSSYTLRILRQLRNIQVTNHSQLFQNMTCELHLTCSVEDADDNVSFRWEALGNTLSSQPNLTVSWDPRISSEQDYTCIAENAVSNLSFSVSAQKLCEDVKIQYTDTK

Extracellular Domain

35-50 kDa

< 1.0 EU per μg protein as determined by the LAL method.

Freeze-dried powder

PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.