Analytical Data
-
Gene name
IL-6R alpha
-
简介
IL-6R alpha is a subunit alpha of IL-6 receptors, also shared by other interleukin receptors. IL-6R alpha acts as IL-6 agonist and involves in JAK/STAT, MAPK, and Akt signaling pathway[1][2]. IL-6R alpha/CD126, Human consists of 468 amino acids (M1-R468) with two fibronectin type-III-like domains contained in the N-terminal part (113-217 a.a, 218-316 a.a), and a soluble form (1-365 a.a). Soluble IL-6R (sIL-6R) binds IL-6 and dimerized gp130 to achieve trans signaling, and exhibits a tissue expression property in some immune systems. IL-6R alpha Protein, Human (L20-P365) is soluble form and expressed by CHO cells with a full length of the sequence of 346 amino acids.
- Application
-
Biological Activity
1. The ED50 is <0.2 μg/mL as measured by M1 cells. 2. Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED50 for this effect is 0.2113 ng/mL in the presence of 2 ng/mL recombinant mouse IL-6, corresponding to a specific activity is 4.73×106 units/mg. Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED50 for this effect is 0.2113 ng/mL in the presence of 2 ng/mL recombinant mouse IL-6, corresponding to a specific activity is 4.73×106units/mg.
-
Alternative Names
rHuIL-6R; IL-6RA; IL-6R 1; CD126; Membrane glycoprotein 80
-
Species
Human
-
Source
CHO
-
Tag
Tag Free
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P08887-1
-
Expression Region
L20-P365
-
AA Sequence
LAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRL
-
Protein Length
Extracellular Domain
-
Molecular Weight
50-58 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Interleukin-6 receptor alpha (IL-6Rα) is a crucial component of the interleukin-6 (IL-6) signaling pathway, which plays a significant role in immune response, inflammation, and hematopoiesis. Dysregulation of IL-6 and its receptor is linked to various disease conditions, including autoimmune disorders, chronic inflammatory diseases, and certain types of cancer. The study of IL-6Rα, particularly the development and application of recombinant proteins, has garnered attention in both therapeutic and diagnostic contexts. Recombinant IL-6Rα proteins can be utilized to better understand the functional mechanisms of IL-6 signaling and to explore potential therapeutic interventions. For example, monoclonal antibodies targeting IL-6Rα, such as tocilizumab, have shown promise in treating diseases like rheumatoid arthritis and cytokine release syndrome. Moreover, the investigation of IL-6Rα's role in signaling cascades contributes to the understanding of its involvement in various pathological conditions, potentially leading to the identification of new therapeutic targets. Recent advancements in recombinant protein technology have enabled the generation of high-quality IL-6Rα proteins, facilitating detailed studies on its structure, function, and interactions with other signaling molecules. Thus, research on IL-6Rα recombinant proteins is pivotal for elucidating the complexities of IL-6-related pathways and developing innovative strategies to combat related diseases.











