Cat: IPD-X21902

Recombinant Human FCRL6 Protein, His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    FCRL6

  • 简介

    The FCRL6 protein acts as a receptor for MHC class II and interacts with HLA-DR when specific beta chains are associated. Although independent stimulation of FCRL6 does not promote cytokine production or cytotoxic activity, it exhibits tyrosine phosphorylation interactions with proteins such as PTPN11, PTPN6, INPP5D, INPPL1, and GRB2. FCRL6 Protein, Human (His) is the recombinant human-derived FCRL6 protein, expressed by E. coli , with N-His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Fc receptor homolog 6; Fc receptor-like 6; Fc receptor-like protein 6; Fc receptor-like protein 7; FcR-like protein 6; FcRH6; FcRL6; FCRL6_HUMAN; FLJ16056; IFGP6; IgSF type I transmembrane receptor; leukocyte receptor

  • Species

    Human

  • Source

    E. coli

  • Tag

    N-His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q6DN72-1

  • Expression Region

    L20-W307

  • AA Sequence

    LYLQAWPNPVFEGDALTLRCQGWKNTPLSQVKFYRDGKFLHFSKENQTLSMGAATVQSRGQYSCSGQVMYIPQTFTQTSETAMVQVQELFPPPVLSAIPSPEPREGSLVTLRCQTKLHPLRSALRLLFSFHKDGHTLQDRGPHPELCIPGAKEGDSGLYWCEVAPEGGQVQKQSPQLEVRVQAPVSRPVLTLHHGPADPAVGDMVQLLCEAQRGSPPILYSFYLDEKIVGNHSAPCGGTTSLLFPVKSEQDAGNYSCEAENSVSRERSEPKKLSLKGSQVLFTPASNW

  • Protein Length

    Extracellular Domain

  • Molecular Weight

    33-36 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

FCRL6 (Fc receptor-like 6) is a member of the FcRL family, which is known for its role in immune regulation. It is an inhibitory receptor primarily expressed on various immune cells, including B cells and some T cell subsets. Research into FCRL6 has gained momentum due to its potential implications in autoimmune diseases, infections, and cancers. The expression of FCRL6 is reported to be altered in various pathological conditions, suggesting its involvement in modulating immune responses. Understanding the molecular mechanisms underlying FCRL6 function can provide insights into how immune tolerance is maintained and how dysregulation can lead to disease. Additionally, the recombinant expression of FCRL6 protein is critical for functional studies, enabling researchers to investigate its interactions with ligands, downstream signaling pathways, and its overall impact on immune cell behavior. Therefore, characterizing FCRL6 through recombinant protein studies is pivotal for exploring its therapeutic potential and deciphering its role in the immune landscape. Insights gained from these studies could pave the way for novel interventions in diseases where immune evasion or dysregulation plays a key role, highlighting FCRL6 as a promising target for future research and clinical applications.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US