Cat: IPD-X21906

Recombinant Rabbit IgG Protein(HEK293)

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    IgG

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Ig gamma chain C region; IgG

  • Species

    Rabbit

  • Source

    HEK293

  • Tag

    Tag Free

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P01870

  • Expression Region

    S101-K323, T185A, N284S

  • AA Sequence

    SKPTCPPPELLGGPSVFIFPPKPKDTLMISRTPEVTCVVVDVSQDDPEVQFTWYINNEQVRTARPPLREQQFNSTIRVVSTLPIAHQDWLRGKEFKCKVHNKALPAPIEKTISKARGQPLEPKVYTMGPPREELSSRSVSLTCMINGFYPSDISVEWEKNGKAEDNYKTTPAVLDSDGSYFLYSKLSVPTSEWQRGDVFTCSVMHEALHNHYTQKSISRSPGK

  • Protein Length

    Partial

  • Molecular Weight

    30-38 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Related Products

Protein Description

Immunoglobulin G (IgG) recombinant proteins have gained significant attention in the fields of biotechnology and medicine due to their critical role in immune responses and therapeutic applications. IgG is the most abundant antibody in the human bloodstream, responsible for neutralizing pathogens and facilitating immune reactions. With advancements in genetic engineering and recombinant DNA technology, scientists can now produce IgG variants in host systems such as bacteria, yeast, or mammalian cells. This enables the generation of highly specific antibodies tailored for diagnostic tools and therapeutic interventions, including treatments for autoimmune diseases, cancers, and infectious diseases. The use of recombinant IgG proteins offers several advantages, such as consistent quality, improved safety profiles, and the ability to modify specific regions for enhanced functionality. Additionally, these proteins serve as valuable tools for research, enabling the study of protein interactions and mechanisms of action in various biological systems. As research continues to evolve, the understanding and application of recombinant IgG proteins are expected to expand, leading to more effective therapies and innovative diagnostic methods. Consequently, the investigation into the structure-function relationships of IgG, along with advancements in production techniques, has the potential to revolutionize the field of immunology and therapeutic drug development.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US