Analytical Data
-
Gene name
IgG2A
-
简介
Ig gamma-2A chain C region (IgG2a) is one of the IgG antibodies subclasses and responses to an antigen. IgG2a plays a crucial role in the adaptive immune response[1][2]. IgG2A Fc Protein, Rat (HEK293) is the recombinant rat-derived IgG2A Fc protein, expressed by HEK293 , with tag free.
- Application
-
Alternative Names
Ig gamma-2 chain C region; IgG2A Fc
-
Species
Rat
-
Source
HEK293
-
Tag
Tag Free
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P20760
-
Expression Region
V98-K322
-
AA Sequence
VPRECNPCGCTGSEVSSVFIFPPKTKDVLTITLTPKVTCVVVDISQNDPEVRFSWFIDDVEVHTAQTHAPEKQSNSTLRSVSELPIVHRDWLNGKTFKCKVNSGAFPAPIEKSISKPEGTPRGPQVYTMAPPKEEMTQSQVSITCMVKGFYPPDIYTEWKMNGQPQENYKNTPPTMDTDGSYFLYSKLNVKKETWQQGNTFTCSVLHEGLHNHHTEKSLSHSPGK
-
Protein Length
Partial
-
Molecular Weight
30-35 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
IgG2a recombinant proteins are critical tools in immunological research and therapeutic applications due to their unique structure and function. Immunoglobulin G (IgG) is the most abundant antibody isotype in serum, and among the various subclasses, IgG2a is known for its ability to effectively mediate immune responses, particularly against protein antigens. The ability to produce IgG2a as a recombinant protein allows researchers to study its functions in detail, evaluate its binding affinity to antigens, and investigate its role in modulating immune responses. Furthermore, IgG2a is often utilized in the development of vaccines and monoclonal antibody therapies, as it can enhance effector functions such as antibody-dependent cellular cytotoxicity (ADCC) and complement activation. The recombinant production of IgG2a not only facilitates the generation of more consistent and ethically sustainable antibody sources but also enables the introduction of specific modifications (e.g., glycosylation patterns) that may enhance its efficacy. As such, ongoing research into IgG2a recombinant proteins contributes significantly to advancements in immunotherapy, vaccine design, and the understanding of antibody-related functions in various diseases, including cancers and autoimmune disorders. Overall, the study of IgG2a recombinant proteins represents a vital intersection of basic immunology and applied biomedical research, with the potential to yield novel therapeutic strategies and improved clinical outcomes.
