Analytical Data
-
Gene name
IgG2B
- Application
-
Alternative Names
IgG2B; IgG2b Fc
-
Species
Others
-
Source
HEK293
-
Tag
Tag Free
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
AAX73259.1
-
Expression Region
E1-S243
-
AA Sequence
EPKTPKPQPQPQPQPNPTTESKCPKCPAPELLGGPSVFIFPPKPKDVLSISGRPEVTCVVVDVGQEDPEVSFNWYIDGAEVRTANTRPKEEQFNSTYRVVSVLPIQHQDWLTGKEFKCKVNNKALPAPIEKTISKAKGQTREPQVYALAPHREELAKDTVSVTCLVKGFYPPDINVEWQRNRQPEPEGTYATTPPQLDNDGTYFLYSKLSVGKNTWQRGETFTCVVMHETLHNHYTQKSISQS
-
Protein Length
Full Length
-
Molecular Weight
35-40 kDa.
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
IgG2b is a subclass of immunoglobulin G (IgG) that plays a crucial role in the immune response, particularly in the context of binding to antigens and facilitating immune processes such as opsonization and antibody-dependent cellular cytotoxicity. Its unique structure and function distinguish it from other IgG subclasses, making it a subject of intense research in both basic and applied immunology. The study of IgG2b recombinant proteins is essential for understanding the functional properties of antibodies, their interactions with various antigens, and the development of therapeutic applications, including monoclonal antibody therapies. By employing recombinant DNA technology, researchers can produce IgG2b proteins in vitro, allowing for detailed examination of their biochemical properties, binding affinities, and efficacy in neutralizing pathogens. Additionally, the ability to tailor the immunogenicity and stability of these proteins enhances their utility in vaccine design and therapeutic interventions. The investigation of IgG2b recombinant proteins contributes to a deeper understanding of immune mechanisms and paves the way for innovative strategies in disease treatment and prevention.











