Cat: IPD-X21937

Recombinant Human IgG3 Protein(HEK293)

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    IgG3

  • 简介

    The IgG3 Fc protein is the constant region of an immunoglobulin heavy chain that acts as a receptor for a specific antigen. IgG3 Fc Protein, Human (HEK293) is the recombinant human-derived IgG3 Fc protein, expressed by HEK293 , with tag free.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Ig gamma-3 chain C region; IGHG3; IgG3 Fc; HDC

  • Species

    Human

  • Source

    HEK293

  • Tag

    Tag Free

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P01860-1

  • Expression Region

    E99-K377

  • AA Sequence

    ELKTPLGDTTHTCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFKWYVDGVEVHNAKTKPREEQYNSTFRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESSGQPENNYNTTPPMLDSDGSFFLYSKLTVDKSRWQQGNIFSCSVMHEALHNRFTQKSLSLSPGK

  • Protein Length

    Partial

  • Molecular Weight

    38-42 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

IgG3 is a critical subclass of immunoglobulin G, known for its efficient ability to mediate immune responses through complement activation and interaction with Fc receptors on immune cells. Its unique structure allows for enhanced binding to pathogens, making it an essential component in the body’s defense mechanisms. Recent studies have focused on recombinant IgG3 proteins due to their potential applications in therapeutic and diagnostic settings, especially in areas such as vaccine development and antibody-based therapies. Advances in recombinant DNA technology have enabled the production of these proteins in host systems, providing a stable and scalable source for research and clinical use. Moreover, understanding the structural and functional properties of IgG3 can lead to the design of more effective monoclonal antibodies. Furthermore, research surrounding IgG3 focuses on elucidating its role in different diseases, including autoimmune disorders and infections. The ability to produce IgG3 in vitro allows for extensive study of its interactions and effects, shedding light on its importance in immune responses. Thus, the exploration of IgG3 recombinant proteins is paving the way for novel insights into immunology and potential therapeutic innovations.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US