Analytical Data
-
Gene name
IgG4
-
简介
The IgG4 Fc is the constant region of the immunoglobulin heavy chain, which forms the backbone of antibodies crucial in humoral immunity. B lymphocytes produce glycoprotein antibodies that initiate clonal expansion upon antigen binding. IgG4 Fc Protein, Human (HEK293) is the recombinant human-derived IgG4 Fc protein, expressed by HEK293 , with tag free.
- Application
-
Biological Activity
sIgG4 Fc immobilized on CM5 Chip can bind FCRN-B2M Heterodimer with an affinity constant of 944.2 nM as determined in SPR assay. sIgG4 Fc immobilized on CM5 Chip can bind FCRN-B2M Heterodimer with an affinity constant of 944.2 nM as determined in SPR assay.
-
Alternative Names
Ig gamma-4 chain C region,IgG4 Fc
-
Species
Human
-
Source
HEK293
-
Tag
Tag Free
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P01861-1
-
Expression Region
E99-G326
-
AA Sequence
ESKYGPPCPSCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLG
-
Protein Length
Partial
-
Molecular Weight
30-35 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
IgG4 recombinant proteins have garnered significant attention in immunological research due to their unique properties and potential therapeutic applications. As a subclass of immunoglobulin G, IgG4 is known for its ability to display anti-inflammatory responses and its role in immune tolerance, which makes it particularly interesting in the context of diseases such as allergies, autoimmune disorders, and cancer. Unlike other IgG subclasses, IgG4 can undergo a process known as "Fab-arm exchange," where two IgG4 molecules can swap their Fab arms, producing bispecific antibodies that may enhance their therapeutic potential. Recent advances in recombinant DNA technology have enabled the production of IgG4 variants that can be tailored for specific functions, increasing their utility in targeted therapies. Understanding the structural and functional nuances of IgG4 is crucial for developing novel treatments and diagnostic tools. Ongoing studies focus on characterizing the immunological mechanisms underlying IgG4 responses and exploring its applications in immunotherapy, particularly in modulating immune responses in various pathological conditions. Its unique characteristics position IgG4 recombinant proteins as promising candidates for future clinical applications, highlighting the need for continued research in this evolving field.











