Analytical Data
-
Gene name
IgG3
-
简介
IgG3 Fc Protein is the high conserved Fc segment of IgG3 (Immunoglobulin G3). Mouse IgG3 Fc protein is involved in several processes, such as activation of immune response, B-cell signaling, complement activation[1][2]. IgG3 Fc Protein, Mouse (HEK293) is the recombinant mouse-derived IgG3 Fc protein, expressed by HEK293 , with tag free.
- Application
-
Alternative Names
rMuIg gamma-3 chain C region/IgG3 Fc; Ig gamma-3 chain C region,IgG3 Fc
-
Species
Mouse
-
Source
HEK293
-
Tag
Tag Free
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P03987-2
-
Expression Region
E97-T306
-
AA Sequence
EPRIPKPSTPPGSSCPPGNILGGPSVFIFPPKPKDALMISLTPKVTCVVVDVSEDDPDVHVSWFVDNKEVHTAWTQPREAQYNSTFRVVSALPIQHQDWMRGKEFKCKVNNKALPAPIERTISKPKGRAQTPQVYTIPPPREQMSKKKVSLTCLVTNFFSEAISVEWERNGELEQDYKNTPPILDSDGTYFLYSKLTVDTDSWLQGEIFTCSVVHEALHNHHTQKNLSRSPGK
-
Protein Length
Partial
-
Molecular Weight
31 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
IgG3 is a critical subclass of immunoglobulin G, known for its efficient ability to mediate immune responses through complement activation and interaction with Fc receptors on immune cells. Its unique structure allows for enhanced binding to pathogens, making it an essential component in the body’s defense mechanisms. Recent studies have focused on recombinant IgG3 proteins due to their potential applications in therapeutic and diagnostic settings, especially in areas such as vaccine development and antibody-based therapies. Advances in recombinant DNA technology have enabled the production of these proteins in host systems, providing a stable and scalable source for research and clinical use. Moreover, understanding the structural and functional properties of IgG3 can lead to the design of more effective monoclonal antibodies. Furthermore, research surrounding IgG3 focuses on elucidating its role in different diseases, including autoimmune disorders and infections. The ability to produce IgG3 in vitro allows for extensive study of its interactions and effects, shedding light on its importance in immune responses. Thus, the exploration of IgG3 recombinant proteins is paving the way for novel insights into immunology and potential therapeutic innovations.











