Analytical Data
-
Gene name
Arginase-2/ARG2
-
简介
Arginase-2/ARG2 Protein, Human (His) expresses in E. coli with a His tag at the N-terminus. Arginase-2 (Arg2) acts as a fasting-induced hepatocyte factor that protects against hepatic and peripheral fat accumulation, hepatic inflammatory responses, and insulin and glucose intolerance in obese murine models[1].
- Application
-
Alternative Names
rHuArginase-2, His; ARG2; Arginase-2
-
Species
Human
-
Source
E. coli
-
Tag
N-6*His
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
P78540
-
Expression Region
H24-G330
-
AA Sequence
HSVAVIGAPFSQGQKRKGVEHGPAAIREAGLMKRLSSLGCHLKDFGDLSFTPVPKDDLYNNLIVNPRSVGLANQELAEVVSRAVSDGYSCVTLGGDHSLAIGTISGHARHCPDLCVVWVDAHADINTPLTTSSGNLHGQPVSFLLRELQDKVPQLPGFSWIKPCISSASIVYIGLRDVDPPEHFILKNYDIQYFSMRDIDRLGIQKVMERTFDLLIGKRQRPIHLSFDIDAFDPTLAPATGTPVVGGLTYREGMYIAEEIHNTGLLSALDLVEVNPQLATSEEEAKTTANLAVDVIASSFGQTREGGHHHHHH
-
Protein Length
Partial
-
Molecular Weight
33.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Arginase-2 (ARG2) is a crucial enzyme that plays a significant role in the urea cycle, responsible for the conversion of arginine to ornithine and urea. This enzyme has gained attention due to its involvement in various physiological and pathological processes, including immune regulation, cancer progression, and cardiovascular diseases. While Arg 1, the other isoform of arginase, primarily operates in the liver, ARG2 is expressed in several tissues and exhibits unique regulatory mechanisms, particularly in immune cells and the tumor microenvironment. The overexpression of ARG2 has been linked to tumor growth and metastasis, as it can modulate the availability of arginine, an amino acid essential for T-cell function and proliferation. Consequently, ARG2 has emerged as a potential therapeutic target, leading to increasing interest in the development of recombinant ARG2 proteins for studying its molecular function, interactions, and potential as a biomarker or therapeutic agent. Characterizing recombinant ARG2 not only enhances the understanding of its enzymatic activity but also facilitates the exploration of its role in various diseases, paving the way for novel treatment strategies aimed at manipulating nitrogen metabolism in pathological conditions.











