Analytical Data
-
Gene name
Ficolin-1
-
简介
IFN-β protein is a recombinant protein that does not use any animal-derived components in its production. It is used in biomedical research and drug manufacturing as a therapeutic agent for a variety of diseases, including multiple sclerosis. Ficolin-1 Protein, Human (HEK293, His) is the recombinant human-derived Ficolin-1 protein, expressed by HEK293 , with C-His labeled tag.
- Application
-
Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized Fetuin at 10 μg/mL (100 μL/well) can bind Human Ficolin-1. The ED50 for this effect is 1.49 μg/mL. Measured by its binding ability in a functional ELISA. Immobilized Fetuin at 10 μg/mL (100 μL/well) can bind Human Ficolin-1. The ED50 for this effect is 1.49 μg/mL.
-
Alternative Names
Ficolin-1; Collagen/fibrinogen domain-containing protein 1; Ficolin-A; FCNM
-
Species
Human
-
Source
HEK293
-
Tag
C-His
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
NP_001994.2
-
Expression Region
A30-A326
-
AA Sequence
ADTCPEVKVVGLEGSDKLTILRGCPGLPGAPGPKGEAGVIGERGERGLPGAPGKAGPVGPKGDRGEKGMRGEKGDAGQSQSCATGPRNCKDLLDRGYFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRMDGSVDFYRDWAAYKQGFGSQLGEFWLGNDNIHALTAQGSSELRVDLVDFEGNHQFAKYKSFKVADEAEKYKLVLGAFVGGSAGNSLTGHNNNFFSTKDQDNDVSSSNCAEKFQGAWWYADCHASNLNGLYLMGPHESYANGINWSAAKGYKYSYKVSEMKVRPA
-
Protein Length
Full Length of Mature Protein
-
Molecular Weight
33-38 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Ficolin-1, also known as elictin, is a pattern recognition receptor that plays a crucial role in the innate immune system. It is primarily produced in the liver and released into the bloodstream, where it participates in the recognition of pathogen-associated molecular patterns (PAMPs) such as bacterial components and certain viruses. The significance of Ficolin-1 lies in its ability to mediate opsonization, enhance phagocytosis, and activate the complement system, thereby contributing to the host's defense against infections. Studies have shown that Ficolin-1 also plays a role in various diseases, including autoimmune disorders and cancer, making it a potential biomarker for disease diagnosis and progression. The recombinant form of Ficolin-1 has gained attention in research, as it offers a valuable tool for studying its biological functions and therapeutic applications. Scientists are exploring its structural properties, interaction with pathogens, and mechanisms of action in immune responses. Additionally, the recombinant protein could be leveraged for developing novel immunotherapeutic strategies aimed at enhancing immune responses or modulating inflammation. Understanding Ficolin-1's role in immunity at a molecular level could pave the way for innovative approaches to treat infectious diseases and autoimmune conditions. Overall, the recombinant study of Ficolin-1 holds promise for expanding our knowledge of innate immunity and developing therapeutic applications to harness or modulate immune functions effectively.











