Cat: IPD-X22813

Recombinant Mouse LYPD3/C4.4A Protein (HEK293),His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    LYPD3/C4.4A

  • 简介

    The LYPD3/C4.4A protein is a multifunctional cell surface molecule that is critical for cell migration and has been implicated in potential tumor progression. It binds laminin 1 and laminin 5, emphasizing its role in extracellular matrix interactions. LYPD3/C4.4A Protein, Mouse (HEK293, His) is the recombinant mouse-derived LYPD3/C4.4A protein, expressed by HEK293 , with C-His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Biological Activity

    Measured by its binding ability in a functional ELISA. When LYPD3 is immobilized at 0.5 μg/mL (100 μL/well), Galectin-3 binds with an apparent KD is 109.3nM. Measured by its binding ability in a functional ELISA. When LYPD3 is immobilized at 0.5 μg/mL (100 μL/well), Galectin-3 binds with an apparent KD is 109.3 nM.

  • Alternative Names

    Ly6/PLAUR domain-containing protein 3; GPI-anchored metastasis-associated protein C4.4A homolog

  • Species

    Mouse

  • Source

    HEK293

  • Tag

    C-His

  • Purity

    Greater than 95% as determined by SDS-PAGE.

  • Uniprot

    Q91YK8

  • Expression Region

    L33-H287

  • AA Sequence

    LECYSCVQKADDGCSPHRMKTVKCGPGVDVCTEAVGAVETIHGQFSVAVRGCGSGIPGKNDRGLDLHGLLAFFQLQQCSEDRCNAKLNLTLRGLNPAGNESAYEPNGAECYSCVGLSREKCQGSMPPVVNCYNASGRVYKGCFDGNVTLTAANVTVSLPVRGCVQDETCTRDGVTGPGFTLSGSCCQGPRCNADLRNKTYFSPRIPPLVLLPPPTTAAPSTRAQNSSSTTSTAAPTTTTSIIKPTTAQASHTSPH

  • Protein Length

    Partial

  • Molecular Weight

    The protein migrates as 45-75 kDa under reducing SDS-PAGE due to glycosylation.

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

LYPD3, also known as C4.4A, is a member of the Ly6 family of glycosylphosphatidylinositol (GPI)-anchored proteins and has gained attention due to its potential role in various biological processes and diseases. Initially identified in T cells, LYPD3 is involved in cell adhesion, signaling, and immune responses. Its expression is particularly notable in tumor microenvironments, suggesting a role in cancer biology. Studies have shown that LYPD3 is associated with the epithelial-mesenchymal transition (EMT), a critical process in cancer metastasis, where cells gain migratory and invasive properties. The reconstitution of LYPD3 as a recombinant protein allows for in-depth examination of its structure and function, as well as its interactions with other cellular proteins and receptors. Furthermore, understanding the role of LYPD3 in immune modulation presents opportunities for therapeutic interventions in cancer and autoimmune diseases. As research progresses, LYPD3/C4.4A may serve as a promising biomarker for diagnosis or prognosis in various cancers, highlighting its significance in both immunology and oncology research.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US