Cat: IPD-X10517

Recombinant Cynomolgus IL-23R beta Protein (HEK293), C-His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    IL-23R beta

  • 简介

    IL-20R beta Protein (IL20RB) is the beta subunit of IL-20 receptor, forms functional heterodimers with different subunit protein and involves in STAT3 activation pathway[1]. The IL-20RA/IL-20RB dimer is a receptor for IL-19, IL-20 and IL-24. The IL-22RA1/IL-20RB dimer is a receptor for IL-20 and IL-24[2]. IL-20R beta Protein is consists of 308 amino acids (M1-S311) with a transmembrane domain (230-254 a.a.). IL-20R beta Protein, Cynomolgus (HEK293, Fc) is fibronectin type-III domain-containing protein, produced in HEK293 cells with a C-Terminal Fc-tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Biological Activity

    Measured by its binding ability in a functional ELISA. Immobilized Human IL-19, at 0.1 μg/mL (100 μL/well) can bind IL-20R beta. The ED50 for this effect is 38.15 ng/mL. Measured by its binding ability in a functional ELISA. Immobilized Human IL-19, at 0.1 μg/mL (100 μL/well) can bind IL-20R beta. The ED50 for this effect is 38.15 ng/mL.

  • Alternative Names

    Interleukin-20 receptor subunit beta; IL-20R-beta; IL-20RB; FNDC6; IL-20R2; DIRS1

  • Species

    Cynomolgus

  • Source

    HEK293

  • Tag

    C-His

  • Purity

    Greater than 95% as determined by reducing SDS-PAGE. as determined by SDS-PAGE.

  • Uniprot

    XP_005545913.1

  • Expression Region

    D30-A230

  • AA Sequence

    DEVAILPAPQNLSVLSTNMKHLLMWSPVTVPGETVYYSVEYQGEYESLYTSHIWIPSSWCSLTEGPECDVTDDITATVPYNLRVRATLGSQTSAWSILKHPFNRNSTILTPPGMEITKDGFHLVIELEDLGPQFEFLVAYWRREPGAEEHVKMVRSGGIPVHLETMEPGAAYCVKAQTFVKAIGRYSAFSQTECVEVQGEA

  • Protein Length

    Partial

  • Molecular Weight

    29-35 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Interleukin-23 receptor (IL-23R) is a crucial component of the immune system, playing a significant role in modulating inflammatory responses and autoimmunity. It interacts with IL-23, a cytokine implicated in various autoimmune diseases, including psoriasis, inflammatory bowel disease, and multiple sclerosis. The study of IL-23R recombinant protein is fundamental for understanding its function and the underlying mechanisms of IL-23-mediated signaling pathways. Researchers are interested in the therapeutic potential of targeting IL-23R, as blocking this receptor could provide novel treatment strategies for patients suffering from IL-23-associated conditions. The recombinant protein can be used for various applications, including developing specific inhibitors and antibodies that target IL-23R, as well as investigating the receptor's structural and functional properties. By elucidating the biology of IL-23R, scientists aim to improve diagnostic and therapeutic approaches, addressing unmet clinical needs in managing inflammatory and autoimmune diseases. Furthermore, understanding variations in IL-23R expression and signaling can lead to personalized medicine strategies, optimizing treatment efficacy based on individual genetic backgrounds. Overall, research on IL-23R recombinant protein holds promise for advancing our understanding of immune regulation and discovering innovative therapies for debilitating inflammatory diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US