Cat: IPD-X27851

Recombinant Human DPYSL2 Protein (P. pastoris),His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    DPYSL2

  • 简介

    DPYSL2 protein plays a crucial role in neuronal development, polarity, axon growth, guidance, growth cone collapse, and cell migration. It is essential for signaling by class 3 semaphorins and cytoskeleton remodeling. DPYSL2 forms homotetramers and heterotetramers with CRMP1, DPYSL3, DPYSL4, or DPYSL5. It interacts with CYFIP1/SRA1, HTR4, CLN6, and MICALL1, highlighting its diverse functions and interactions in cellular processes. DPYSL2 Protein, Human (P.pastoris, His) is the recombinant human-derived DPYSL2 protein, expressed by P. pastoris , with N-His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Collapsin response mediator protein 2; Collapsin response mediator protein hCRMP 2; CRAM; CRMP 2; CRMP-2; N2A3; TOAD 64; TOAD64; ULIP 2 protein; ULIP-2; Ulip2

  • Species

    Human

  • Source

    P. pastoris

  • Tag

    N-His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q16555

  • Expression Region

    M1-G572

  • AA Sequence

    MSYQGKKNIPRITSDRLLIKGGKIVNDDQSFYADIYMEDGLIKQIGENLIVPGGVKTIEAHSRMVIPGGIDVHTRFQMPDQGMTSADDFFQGTKAALAGGTTMIIDHVVPEPGTSLLAAFDQWREWADSKSCCDYSLHVDISEWHKGIQEEMEALVKDHGVNSFLVYMAFKDRFQLTDCQIYEVLSVIRDIGAIAQVHAENGDIIAEEQQRILDLGITGPEGHVLSRPEEVEAEAVNRAITIANQTNCPLYITKVMSKSSAEVIAQARKKGTVVYGEPITASLGTDGSHYWSKNWAKAAAFVTSPPLSPDPTTPDFLNSLLSCGDLQVTGSAHCTFNTAQKAVGKDNFTLIPEGTNGTEERMSVIWDKAVVTGKMDENQFVAVTSTNAAKVFNLYPRKGRIAVGSDADLVIWDPDSVKTISAKTHNSSLEYNIFEGMECRGSPLVVISQGKIVLEDGTLHVTEGSGRYIPRKPFPDFVYKRIKARSRLAELRGVPRGLYDGPVCEVSVTPKTVTPASSAKTSPAKQQAPPVRNLHQSGFSLSGAQIDDNIPRRTTQRIVAPPGGRANITSLG

  • Protein Length

    Full Length

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

DPYSL2 (Developmentally Regulated, Psychostimulatory Drug-Induced Gene 2) is a member of the collapsin response mediator protein (CRMP) family, which plays a crucial role in neuronal development and functioning. Researchers have increasingly focused on DPYSL2 due to its involvement in critical processes such as neurite outgrowth, axon guidance, and synaptic plasticity. Dysregulation of DPYSL2 has been implicated in various neurological disorders, including schizophrenia, Alzheimer's disease, and autism spectrum disorders. As a result, understanding the structure and function of DPYSL2 is essential for elucidating its role in these conditions. The study of recombinant DPYSL2 protein enables scientists to investigate its biological properties in a controlled environment, providing insights into its interactions with other cellular components and potential pathways involved in neurodevelopmental processes. Furthermore, exploring DPYSL2's molecular mechanisms has the potential to uncover novel therapeutic targets for treating related neurological disorders, making it a significant focus of current biomedical research.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US