Analytical Data
-
Gene name
Apolipoprotein E/APOE
-
简介
Apolipoprotein E/APOE is essential for lipid transport between organs and is a key component of lipoproteins such as chylomicrons and high-density lipoprotein. It binds to cell receptors such as LDLR and VLDLR to promote lipoprotein uptake, and has heparin-binding activity to interact with cell surface proteoglycans. Apolipoprotein E/APOE Protein, Rabbit (His-SUMO) is the recombinant Rabbit-derived Apolipoprotein E/APOE protein, expressed by E. coli , with N-10*His, N-SUMO labeled tag.
- Application
-
Alternative Names
APOEApolipoprotein E; Apo-E
-
Species
Rabbit
-
Source
E. coli
-
Tag
N-10*His;N-SUMO
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P18287
-
Expression Region
T20-Q311
-
AA Sequence
TEQEVEVPEQARWKAGQPWELALGRFWDYLRWVQSLSDQVQEELLSSQVTQELTMLMEETMKEVKAYKSELEEQLSPMAQEHRARLSKELQVAGALEADMEDVCNRLAQYRGEAQAMLGQSTEELARAFSSHLRKLRKRLLRDAEDLQKRMAVYGAGAREGAERGVSAVRERLGSRLERGRLRVATVGTLAGRPLRERAQAWGERLRGHLEEVGSRARDRLNEVREQVEEVRVKVEEQAPQMRLQAEAFQARLKSWFEPLVEDMQRQWAGLVEKLQAAMPSKAPAAAPIENQ
-
Protein Length
Full Length of Mature Protein
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Apolipoprotein E (APOE) is a pivotal protein involved in lipid metabolism and neurobiology, primarily recognized for its role in the transport and clearance of lipoproteins in the bloodstream. The APOE gene exhibits three major alleles: ε2, ε3, and ε4, with the ε4 variant being a significant genetic risk factor for Alzheimer's disease and other neurodegenerative disorders. Research into recombinant APOE protein has gained momentum due to its potential in elucidating the mechanisms underlying these diseases and its therapeutic implications. Recombinant APOE proteins are crucial for studying their structure-function relationships, lipid-binding properties, and interactions with receptors like the LDL receptor and ApoE receptors. By producing and characterizing these proteins in vitro, researchers aim to understand how variations in APOE affect lipid metabolism, amyloid plaque formation, and neural repair processes. Furthermore, the recombinant forms can be employed in animal models to assess their influence on disease progression and treatment outcomes. This growing body of research not only enhances our understanding of APOE's biological roles but also opens avenues for developing targeted therapies aimed at mitigating the effects of APOE-related pathologies. As Alzheimer’s disease continues to be a pressing global health issue, the development and application of recombinant APOE proteins represent a promising direction in the quest for effective diagnostics and treatments.











