Analytical Data
-
Gene name
EN1
-
简介
EN1 Protein is essential for the correct formation of the apical ectodermal ridge and accurate dorsal-ventral patterning in the limb. EN1 Protein, Gallus gallus (His-B2M) is the recombinant EN1 protein, expressed by E. coli , with N-6*His, B2M labeled tag.
- Application
-
Alternative Names
EN1; EN-1; Homeobox protein engrailed-1; Gg-En-1; Homeobox protein en-1
-
Species
Others
-
Source
E. coli
-
Tag
N-6*His;B2M
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q05916
-
Expression Region
M1-E333
-
AA Sequence
MEEPPEGHGHHRDAAPPGPANGGGGGGGGSDGDSAPVSPSPAPASPAAPCPLPLPRRRPPPPPPPRTTNFFIDNILRPDFGCKKEPPAATGAATGAGGGGGGGGREQRDGAQSAGRENVNPLLARPPHAPSSALLCPDSNCAPDGSAPAGTAAKANPGTAAGAAGAAGAAKAQGDGGETPAAKYGEHGSPAILLMGSNNGGAVLKPDSQQPLVWPAWVYCTRYSDRPSSPRTRKLKKKKTEKEDKRPRTAFTAEQLQRLKAEFQANRYITEQRRQSLAQELSLNESRVKIWFQNKRAKIKKATGIKNGLALHLMAQGLYNHSTTTVQDKEESE
-
Protein Length
Full Length
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
EN1, or Engrailed 1, is a transcription factor that plays a crucial role in embryonic development, particularly in the patterning and differentiation of neural tissues. It is primarily expressed in the midbrain and the hindbrain during early vertebrate development. Research into EN1 has gained momentum due to its involvement in various neurodevelopmental processes and its potential implications in neurodegenerative diseases and cancer. The study of EN1 recombinant proteins has become essential for understanding its functional mechanisms at the molecular level, as well as its interactions with other proteins and DNA elements. By engineering EN1 as a recombinant protein, researchers aim to investigate its structural properties and binding affinities, which may unveil new insights into its role in cellular signaling pathways and gene expression regulation. Additionally, the study of EN1 recombinant proteins can provide valuable information for developing targeted therapies for conditions associated with aberrant EN1 expression, such as autism spectrum disorders and certain types of tumors. Thus, the exploration of EN1 and its recombinant forms is a promising avenue in developmental biology, neurobiology, and therapeutic research, highlighting the importance of this transcription factor in both health and disease.
