Analytical Data
-
Gene name
ANGPTL4/Angiopoietin-related 4
-
简介
Angiopoietin-like protein 4, Human modulates the disposition of circulating triglycerides (TG) by inhibiting lipoprotein lipase (LPL). Angiopoietin-Related Protein 4 is a conventional, non-competitive inhibitor that binds to LPL to prevent the hydrolysis of substrate as part of reversible mechanism.
- Application
-
Biological Activity
1.Measured by its binding ability in a functional ELISA. When Recombinant Human Angiopoietin-like 4/ANGPTL4 is immobilized at 1 μg/mL, 100 μL/well can bind Recombinant Human LILRB2/CD85d/ILT4. The ED50 for this effect is <350 ng/mL. 2.Human LILRB2 immobilized on CM5 Chip can bind ANGPTL4 with an affinity constant of 71.05 nM as determined in a SPR assay. Measured by its binding ability in a functional ELISA. When Recombinant Human Angiopoietin-like 4/ANGPTL4 is immobilized at 1 μg/mL, 100 μL/well can bind Recombinant Human LILRB2/CD85d/ILT4. The ED50 for this effect is 327.9 ng/mL.
-
Alternative Names
rHuAngiopoietin-Related Protein 4, His; ANGPTL4; Angiopoietin-Related Protein 4
-
Species
Human
-
Source
HEK293
-
Tag
N-6*His
-
Purity
Greater than 95% as determined by reducing SDS-PAGE.
-
Uniprot
Q9BY76-1
-
Expression Region
P166-S406
-
AA Sequence
PEMAQPVDPAHNVSRLHRLPRDCQELFQVGERQSGLFEIQPQGSPPFLVNCKMTSDGGWTVIQRRHDGSVDFNRPWEAYKAGFGDPHGEFWLGLEKVHSITGDRNSRLAVQLRDWDGNAELLQFSVHLGGEDTAYSLQLTAPVAGQLGATTVPPSGLSVPFSTWDQDHDLRRDKNCAKSLSGGWWFGTCSHSNLNGQYFRSIPQQRQKLKKGIFWKTWRGRYYPLQATTMLIQPMAAEAAS
-
Protein Length
Partial
-
Molecular Weight
31-38 kDa.
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ANGPTL4, or Angiopoietin-like 4, is a protein that plays a critical role in regulating lipid metabolism, inflammation, and angiogenesis. Discovered as a key factor in metabolic disorders, ANGPTL4 is primarily produced in various tissues, including adipose tissue, liver, and muscles. Its unique ability to inhibit lipoprotein lipase (LPL) leads to increased plasma triglyceride levels, linking it to obesity, diabetes, and cardiovascular diseases. Furthermore, ANGPTL4 has been implicated in tumor biology, where it can either inhibit or promote cancer progression depending on the context. Research into ANGPTL4 has gained momentum due to its potential as a biomarker for metabolic disorders and as a therapeutic target. Recombinant ANGPTL4 proteins are being explored for their functional roles in these pathways, providing insights into their biology and potential applications in treatment. Understanding the mechanisms behind ANGPTL4's diverse functions could pave the way for innovative strategies in managing metabolic diseases and cancer therapies.











