Analytical Data
-
Gene name
NDRG1
-
简介
NDRG1 is a stress-responsive protein and an important tumor suppressor involved in hormone response and cell growth. It aids in Schwann cell transport, which is essential for the development of myelin in peripheral nerves. NDRG1 Protein, Human (His) is the recombinant human-derived NDRG1 protein, expressed by E. coli , with N-6*His labeled tag.
- Application
-
Species
Human
-
Source
E. coli
-
Tag
N-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q92597
-
Expression Region
M1-C394
-
AA Sequence
MSREMQDVDLAEVKPLVEKGETITGLLQEFDVQEQDIETLHGSVHVTLCGTPKGNRPVILTYHDIGMNHKTCYNPLFNYEDMQEITQHFAVCHVDAPGQQDGAASFPAGYMYPSMDQLAEMLPGVLQQFGLKSIIGMGTGAGAYILTRFALNNPEMVEGLVLINVNPCAEGWMDWAASKISGWTQALPDMVVSHLFGKEEMQSNVEVVHTYRQHIVNDMNPGNLHLFINAYNSRRDLEIERPMPGTHTVTLQCPALLVVGDSSPAVDAVVECNSKLDPTKTTLLKMADCGGLPQISQPAKLAEAFKYFVQGMGYMPSASMTRLMRSRTASGSSVTSLDGTRSRSHTSEGTRSRSHTSEGTRSRSHTSEGAHLDITPNSGAAGNSAGPKSMEVSC
-
Protein Length
Full Length
-
Molecular Weight
50.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ERO1L (ERO1-like) is a crucial protein in the endoplasmic reticulum (ER) responsible for the formation of disulfide bonds in nascent proteins, playing a vital role in protein folding and maturation. Its importance is underscored in various cellular processes, including stress responses and protein homeostasis. ERO1L is particularly significant in the context of diseases characterized by protein misfolding, such as neurodegenerative disorders and certain cancers, as its dysfunction can lead to ER stress and subsequent apoptosis. Research into ERO1L has expanded in recent years, highlighting its potential as a therapeutic target. Studies indicate that modulating ERO1L activity can influence various cellular pathways, including those involved in oxidative stress responses and inflammation. Given its essential role in maintaining cellular function and homeostasis, ERO1L's investigation offers insights into both fundamental biological processes and the development of novel therapeutic strategies in treating diseases linked to ER stress and protein misfolding. Understanding the biophysical properties, enzymatic mechanisms, and regulatory pathways of ERO1L can lead to a more comprehensive grasp of cellular health and disease states, paving the way for innovative interventions in related pathologies. As a result, the recombination and functional characterization of ERO1L have become pivotal in molecular biology and biomedicine, offering a promising avenue for developing future therapeutic approaches.
