Cat: IPD-X28300

Recombinant Human NR3C1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    NR3C1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    GCCR; GCR; GCR_HUMAN; GCRST; glucocorticoid nuclear receptor variant 1; Glucocorticoid receptor; GR; GRL; Grl1; nr3c1; Nuclear receptor subfamily 3 group C member 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    C-6*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P04150-1

  • Expression Region

    V521-K777

  • AA Sequence

    VPATLPQLTPTLVSLLEVIEPEVLYAGYDSSVPDSTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSWMFLMAFALGWRSYRQSSANLLCFAPDLIINEQRMTLPCMYDQCKHMLYVSSELHRLQVSYEEYLCMKTLLLLSSVPKDGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRFYQLTKLLDSMHEVVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSNGNIKKLLFHQK

  • Protein Length

    Partial

  • Molecular Weight

    35 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

NR3C1, also known as the glucocorticoid receptor (GR), is a member of the nuclear receptor superfamily that plays a crucial role in mediating the effects of glucocorticoids, which are steroid hormones involved in a variety of physiological processes including stress response, immune function, and metabolism. The study of NR3C1 recombinant proteins has gained significance due to their potential applications in understanding hormonal signaling pathways and developing therapeutic interventions for various diseases, including metabolic disorders, autoimmune diseases, and cancers. The NR3C1 gene undergoes complex regulation and can exhibit alternative splicing, leading to different isoforms that may have distinct functions and tissue-specific roles. The recombinant expression of NR3C1 proteins allows researchers to investigate these isoforms' functional characteristics and interactions with other cellular pathways. Furthermore, studying NR3C1 in a recombinant form can aid in the development of drugs that target this receptor, improving treatment strategies for conditions such as Cushing's syndrome and chronic inflammatory diseases. As research progresses, the insights gained from NR3C1 recombinant protein studies are expected to enhance our understanding of glucocorticoid biology and its implications for human health.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US