Analytical Data
-
Gene name
MMP-9
-
简介
The MMP-9 protein is a matrix metalloproteinase that is critical for local extracellular matrix proteolysis and leukocyte migration.It is suggested that it may be involved in bone osteoclastic resorption.MMP-9 Protein, Mouse (HEK293) is the recombinant mouse-derived MMP-9 protein, expressed by HEK293 , with tag free.
- Application
-
Alternative Names
Matrix metalloproteinase-9; MMP-9; Gelatinase B; GELB; CLG4B
-
Species
Mouse
-
Source
HEK293
-
Tag
Tag Free
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
P41245
-
Expression Region
P21-P730
-
AA Sequence
PYQRQPTFVVFPKDLKTSNLTDTQLAEAYLYRYGYTRAAQMMGEKQSLRPALLMLQKQLSLPQTGELDSQTLKAIRTPRCGVPDVGRFQTFKGLKWDHHNITYWIQNYSEDLPRDMIDDAFARAFAVWGEVAPLTFTRVYGPEADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGAGVQGDAHFDDDELWSLGKGVVIPTYYGNSNGAPCHFPFTFEGRSYSACTTDGRNDGTPWCSTTADYDKDGKFGFCPSERLYTEHGNGEGKPCVFPFIFEGRSYSACTTKGRSDGYRWCATTANYDQDKLYGFCPTRVDATVVGGNSAGELCVFPFVFLGKQYSSCTSDGRRDGRLWCATTSNFDTDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMYPLYSYLEGFPLNKDDIDGIQYLYGRGSKPDPRPPATTTTEPQPTAPPTMCPTIPPTAYPTVGPTVGPTGAPSPGPTSSPSPGPTGAPSPGPTAAPTAGSSEASTESLSPADNPCNVDVFDAIAEIQGALHFFKDGWYWKFLNHRGSPLQGPFLTARTWPALPATLDSAFEDPQTKRVFFFSGRQMWVYTGKTVLGPRSLDKLGLGPEVTHVSGLLPRRPGKALLFSKGRVWRFDLKSQKVDPQSVIRVDKEFSGVPWNSHDIFQYQDKAYFCHGKFFWRVSFQNEVNKVDPEVNQVDDVGYVTYDLLQCP
-
Protein Length
Partial
-
Molecular Weight
80-105 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Matrix metalloproteinase-9 (MMP-9) is a zinc-dependent endopeptidase that plays a critical role in the degradation of extracellular matrix components, which is essential for various physiological processes, including tissue remodeling, wound healing, and angiogenesis. Abnormal regulation of MMP-9 has been implicated in numerous pathological conditions, such as cancer metastasis, cardiovascular diseases, and inflammatory disorders. As a result, MMP-9 has emerged as a significant biomarker and therapeutic target in these contexts. The recombinant protein form of MMP-9 allows for detailed studies of its functional properties, enzymatic activity, and interaction with specific inhibitors. Researchers have focused on understanding the structure-activity relationship of MMP-9, developing potent MMP inhibitors, and exploring potential applications in drug delivery systems. Additionally, the recombinant expression of MMP-9 provides valuable insights into its mechanism of action and the molecular pathways it affects, paving the way for the development of new therapeutic strategies aimed at modulating MMP-9 activity to treat various diseases. As the understanding of MMP-9's role in health and disease deepens, the opportunity to harness recombinant technology for both research and clinical applications continues to expand.
