Cat: IPD-X32850

Recombinant Human MMP-16 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    MMP-16

  • 简介

    The MMP-16 protein functions as an endopeptidase capable of degrading various components of the extracellular matrix, particularly type III collagen and fibronectin. Its effects extend to the activation of progelatinase A, which contributes to the dynamic remodeling of the extracellular matrix within blood vessels. MMP-16 Protein, Human (I152N, His) is the recombinant human-derived MMP-16 protein, expressed by E. coli , with C-10*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Species

    Human

  • Source

    E. coli

  • Tag

    C-10*His

  • Purity

    Greater than 95% as determined by SDS-PAGE.

  • Uniprot

    P51512

  • Expression Region

    A32-G291, I152N

  • AA Sequence

    ATVCGTEQYFNVEVWLQKYGYLPPTDPRMSVLRSAETMQSALAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFHIRRKRYALTGQKWQHKHITYSIKNVTPKVGDPETRKANRRAFDVWQNVTPLTFEEVPYSELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYG

  • Protein Length

    Partial

  • Molecular Weight

    29 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

MMP-16, also known as membrane-type matrix metalloproteinase-16 (MT-MMP-16), is a member of the matrix metalloproteinase (MMP) family, which plays a crucial role in the degradation of extracellular matrix components. This enzyme is primarily involved in processes such as tissue remodeling, wound healing, and tumor invasion. The study of MMP-16 has gained significant attention due to its potential implications in various pathological conditions, including cancer metastasis and cardiovascular diseases. Research indicates that MMP-16 is upregulated in several tumor types, suggesting its involvement in promoting tumor growth and invasion by facilitating the breakdown of tissue barriers. Additionally, MMP-16 has been implicated in the processing of other MMPs and growth factors, further highlighting its importance in cellular communication and signaling pathways. Understanding the structure and function of MMP-16, particularly through the development of recombinant proteins, can provide insights into its role in disease progression and may lead to the identification of novel therapeutic targets. Furthermore, studying recombinant MMP-16 can aid in elucidating its enzymatic mechanisms, regulation, and interaction with inhibitors, potentially paving the way for advancements in drug design aimed at mitigating the adverse effects of diseases associated with aberrant MMP activity.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US