Analytical Data
-
Gene name
MMP-16
-
简介
The MMP-16 protein functions as an endopeptidase capable of degrading various components of the extracellular matrix, particularly type III collagen and fibronectin. Its effects extend to the activation of progelatinase A, which contributes to the dynamic remodeling of the extracellular matrix within blood vessels. MMP-16 Protein, Human (I152N, His) is the recombinant human-derived MMP-16 protein, expressed by E. coli , with C-10*His labeled tag.
- Application
-
Species
Human
-
Source
E. coli
-
Tag
C-10*His
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
P51512
-
Expression Region
A32-G291, I152N
-
AA Sequence
ATVCGTEQYFNVEVWLQKYGYLPPTDPRMSVLRSAETMQSALAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFHIRRKRYALTGQKWQHKHITYSIKNVTPKVGDPETRKANRRAFDVWQNVTPLTFEEVPYSELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYG
-
Protein Length
Partial
-
Molecular Weight
29 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MMP-16, also known as membrane-type matrix metalloproteinase-16 (MT-MMP-16), is a member of the matrix metalloproteinase (MMP) family, which plays a crucial role in the degradation of extracellular matrix components. This enzyme is primarily involved in processes such as tissue remodeling, wound healing, and tumor invasion. The study of MMP-16 has gained significant attention due to its potential implications in various pathological conditions, including cancer metastasis and cardiovascular diseases. Research indicates that MMP-16 is upregulated in several tumor types, suggesting its involvement in promoting tumor growth and invasion by facilitating the breakdown of tissue barriers. Additionally, MMP-16 has been implicated in the processing of other MMPs and growth factors, further highlighting its importance in cellular communication and signaling pathways. Understanding the structure and function of MMP-16, particularly through the development of recombinant proteins, can provide insights into its role in disease progression and may lead to the identification of novel therapeutic targets. Furthermore, studying recombinant MMP-16 can aid in elucidating its enzymatic mechanisms, regulation, and interaction with inhibitors, potentially paving the way for advancements in drug design aimed at mitigating the adverse effects of diseases associated with aberrant MMP activity.











