Analytical Data
-
Gene name
GOLM1
-
简介
GOLM1 Protein, amid partial comprehension, acts as a cellular response protein to viral infections, with an intricate role yet to be fully understood. Interactions with DYM suggest potential links to cellular dynamics or host-virus interactions. Further investigation is crucial to delineate GOLM1's specific contributions and implications in cellular defense mechanisms against viral infections. GOLM1 Protein, Human (His, Solution) is the recombinant human-derived GOLM1 protein, expressed by E. coli , with N-6*His labeled tag.
- Application
-
Species
Human
-
Source
E. coli
-
Tag
N-6*His
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
Q8NBJ4-1
-
Expression Region
S36-L401
-
AA Sequence
SSRSVDLQTRIMELEGRVRRAAAERGAVELKKNEFQGELEKQREQLDKIQSSHNFQLESVNKLYQDEKAVLVNNITTGERLIRVLQDQLKTLQRNYGRLQQDVLQFQKNQTNLERKFSYDLSQCINQMKEVKEQCEERIEEVTKKGNEAVASRDLSENNDQRQQLQALSEPQPRLQAAGLPHTEVPQGKGNVLGNSKSQTPAPSSEVVLDSKRQVEKEETNEIQVVNEEPQRDRLPQEPGREQVVEDRPVGGRGFGGAGELGQTPQVQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDDYNMDENEAESETDKQAALAGNDRNIDVFNVEDQKRDTINLLDQREKRNHTL
-
Protein Length
Lumenal Domain
-
Molecular Weight
60 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GOLM1, also known as Golgi membrane protein 1, is a protein that is primarily localized in the Golgi apparatus and is implicated in various cellular processes, including protein sorting and trafficking. Recent studies have highlighted its potential role in cancer biology, as GOLM1 expression is often upregulated in several types of tumors, making it a promising biomarker for cancer diagnostics and a potential target for therapeutic intervention. The understanding of GOLM1's function and its interactions at the molecular level could provide insights into tumor progression and metastasis. Moreover, recombinant GOLM1 protein has been utilized in research to study its structural properties and interactions with other cellular components, further illuminating its biological significance. The continued investigation of GOLM1 may pave the way for novel strategies in cancer treatment and personalized medicine, addressing the need for effective biomarkers that can aid in early detection and monitoring of cancer progression. Consequently, research into GOLM1 recombinant proteins is not only vital for elucidating its functional roles but also for exploring its utility in clinical applications.
