Analytical Data
-
Gene name
LSP1
-
简介
The LSP1 protein may play an important role in mediating neutrophil activation and chemotaxis, suggesting its involvement in immune responses. LSP1 is known to bind actin and may influence cytoskeletal dynamics critical for cell migration. LSP1 Protein, Human (HEK293, His) is the recombinant human-derived LSP1 protein, expressed by HEK293 , with C-His labeled tag.
- Application
-
Alternative Names
Lymphocyte-specific protein 1; 52 kDa phosphoprotein; pp52; WP34
-
Species
Human
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
P33241-1
-
Expression Region
M1-P339
-
AA Sequence
MAEASSDPGAEEREELLGPTAQWSVEDEEEAVHEQCQHERDRQLQAQDEEGGGHVPERPKQEMLLSLKPSEAPELDEDEGFGDWSQRPEQRQQHEGAQGALDSGEPPQCRSPEGEQEDRPGLHAYEKEDSDEVHLEELSLSKEGPGPEDTVQDNLGAAGAEEEQEEHQKCQQPRTPSPLVLEGTIEQSSPPLSPTTKLIDRTESLNRSIEKSNSVKKSQPDLPISKIDQWLEQYTQAIETAGRTPKLARQASIELPSMAVASTKSRWETGEVQAQSAAKTPSCKDIVAGDMSKKSLWEQKGGSKTSSTIKSTPSGKRYKFVATGHGKYEKVLVEGGPAP
-
Protein Length
Full Length of Isoform-1
-
Molecular Weight
60 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
LSP1 (Lymphocyte-Specific Protein 1) is an essential protein that plays a crucial role in immune responses and lymphocyte function. Research on LSP1 has garnered attention due to its involvement in various biological processes, particularly in the regulation of cell migration, adhesion, and signaling pathways in leukocytes. The significance of LSP1 extends to its association with numerous diseases, including autoimmune disorders, cancer, and cardiovascular conditions, making it a potential therapeutic target. Recent advancements in recombinant protein technology have facilitated the production of LSP1 for functional studies, enabling researchers to investigate its structure, interactions, and biological functions in depth. Understanding the molecular mechanisms of LSP1 can provide insights into lymphocyte development and activation, offering pathways for innovative treatments in related diseases. The exploration of LSP1 through recombinant protein research not only enhances our comprehension of immune system dynamics but also opens avenues for the development of targeted therapies aimed at modulating immune responses.











