Cat: IPD-X30217

Recombinant Mouse Cathepsin L1 Protein (HEK293),His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Cathepsin L1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    rMuCathepsin L, His; Cathepsin L1; Major excreted protein; p39 cysteine proteinase; CTSL1

  • Species

    Mouse

  • Source

    HEK293

  • Tag

    C-His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P06797

  • Expression Region

    T18-N334

  • AA Sequence

    TPKFDQTFSAEWHQWKSTHRRLYGTNEEEWRRAIWEKNMRMIQLHNGEYSNGQHGFSMEMNAFGDMTNEEFRQVVNGYRHQKHKKGRLFQEPLMLKIPKSVDWREKGCVTPVKNQGQCGSCWAFSASGCLEGQMFLKTGKLISLSEQNLVDCSHAQGNQGCNGGLMDFAFQYIKENGGLDSEESYPYEAKDGSCKYRAEFAVANDTGFVDIPQQEKALMKAVATVGPISVAMDASHPSLQFYSSGIYYEPNCSSKNLDHGVLLVGYGYEGTDSNKNKYWLVKNSWGSEWGMEGYIKIAKDRDNHCGLATAASYPVVNHHHHHH

  • Protein Length

    Full Length of Mature Protein

  • Molecular Weight

    36.02 kDa.

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Cathepsin L1 is a cysteine protease that plays a crucial role in various biological processes, including protein degradation, antigen processing, and apoptosis. It is widely expressed in different tissues and is particularly implicated in cancer progression, immune response, and various inflammatory conditions. Research has shown that Cathepsin L1 is involved in the remodeling of the extracellular matrix, which is vital for tumor metastasis and tissue repair. Due to its significant role in disease, Cathepsin L1 has emerged as a potential therapeutic target. The recombinant Cathepsin L1 protein offers a powerful tool for studying its biochemical properties and physiological functions in vitro and in vivo. By producing and characterizing this recombinant protein, researchers can dissect the enzymatic mechanisms underlying its activity and interactions with substrates. Moreover, understanding the structure-function relationship of Cathepsin L1 could lead to the development of novel inhibitors or therapies that could impede its activity in pathological conditions. Additionally, recombinant Cathepsin L1 provides an avenue for exploring its diagnostic potential as a biomarker for certain diseases. Overall, the study of recombinant Cathepsin L1 protein is pivotal in advancing our understanding of its biological significance and its implications in health and disease.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US