Analytical Data
-
Gene name
DTE
- Application
-
Alternative Names
D-tagatose 3-epimerase; Ketose 3-epimerase
-
Species
Pseudomonas cichorii
-
Source
E. coli
-
Tag
N-10*His;C-Myc
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O50580
-
Expression Region
M1-A290
-
AA Sequence
MNKVGMFYTYWSTEWMVDFPATAKRIAGLGFDLMEISLGEFHNLSDAKKRELKAVADDLGLTVMCCIGLKSEYDFASPDKSVRDAGTEYVKRLLDDCHLLGAPVFAGLTFCAWPQSPPLDMKDKRPYVDRAIESVRRVIKVAEDYGIIYALEVVNRFEQWLCNDAKEAIAFADAVDSPACKVQLDTFHMNIEETSFRDAILACKGKMGHFHLGEANRLPPGEGRLPWDEIFGALKEIGYDGTIVMEPFMRKGGSVSRAVGVWRDMSNGATDEEMDERARRSLQFVRDKLA
-
Protein Length
Full Length
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DTE (Dipeptidyl Peptidase IV, also known as DPP-4) is a key enzyme involved in various physiological processes, including glucose metabolism, immune response, and cellular signaling. Its role in the inactivation of several bioactive peptides, such as incretins, has made it a target of significant interest in diabetes research, particularly in the context of type 2 diabetes management. Recent studies have highlighted the importance of DTE's structural and functional characteristics, as they can influence substrate specificity and enzymatic activity. Advances in recombinant DNA technology have enabled the production of modified DTE proteins, allowing researchers to explore their potential therapeutic applications, including as inhibitors in diabetic therapies and modulators of immune responses. The investigation of DTE's role extends beyond diabetes; its implications in cancer biology and cardiovascular health have started to emerge, underscoring the necessity for a deeper understanding of its mechanisms. As the field advances, there is a growing emphasis on structure-function relationships, which could pave the way for novel therapeutic strategies targeting DTE and related pathways, ultimately improving health outcomes in various diseases.











