Cat: IPD-X33584

Recombinant Human Glutamine synthetase/GLUL Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Glutamine synthetase/GLUL

  • 简介

    GLUL proteins catalyze the conversion of glutamate and ammonia to glutamine. Glutamine synthetase/GLUL Protein, Human (His) is the recombinant human-derived Glutamine synthetase/GLUL protein, expressed by E. coli , with C-6*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    rHuGlutamine synthetase/GLUL, His; Glutamine Synthetase; GS; Glutamate Decarboxylase; Glutamate--Ammonia Ligase; GLUL; GLNS

  • Species

    Human

  • Source

    E. coli

  • Tag

    C-6*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P15104

  • Expression Region

    T2-N373

  • AA Sequence

    TTSASSHLNKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDSEPKCVEELPEWNFDGSSTLQSEGSNSDMYLVPAAMFRDPFRKDPNKLVLCEVFKYNRRPAETNLRHTCKRIMDMVSNQHPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADRAYGRDIVEAHYRACLYAGVKIAGTNAEVMPAQWEFQIGPCEGISMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTNFSTKAMREENGLKYIEEAIEKLSKRHQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFSVTEALIRTCLLNETGDEPFQYKN

  • Protein Length

    Full Length of Mature Protein

  • Molecular Weight

    40-50 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Glutamine synthetase (GS), encoded by the GLUL gene, plays a crucial role in nitrogen metabolism and neurotransmitter regulation in both prokaryotic and eukaryotic organisms. This enzyme catalyzes the ATP-dependent conversion of glutamate and ammonia into glutamine, which is essential for synthesizing proteins, nucleotides, and other biomolecules. Dysregulation of glutamine levels has been implicated in various pathological conditions, including neurodegenerative diseases, metabolic disorders, and certain cancers. The study of recombinant glutamine synthetase has gained prominence due to its potential applications in biochemistry and medicine. Researchers have focused on producing recombinant GS to investigate its structural properties, enzymatic mechanisms, and regulatory pathways. Additionally, recombinant GS can be utilized as a tool in metabolic engineering, aiding in the development of microbial strains with enhanced nitrogen assimilation capabilities. Understanding the function and regulation of glutamine synthetase through recombinant protein studies provides valuable insights into nutrient metabolism and opens avenues for therapeutic interventions in diseases linked to metabolic dysregulation.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US