Cat: IPD-X30481

Recombinant Human Kallikrein-11 Protein (Baculovirus)

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Kallikrein-11

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    rHuKallikrein-11; TLSP; hK11; Hippostasin; Trypsin-like protease; Serine protease 20

  • Species

    Human

  • Source

    Baculovirus

  • Tag

    Tag Free

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9UBX7-2

  • Expression Region

    E51-N282

  • AA Sequence

    EFAATMLLVNQSHQGFNKEHTSKMVSAIVLYVLLAAAAHSAFAHHHHHHGSGSDDDDKETRIIKGFECKPHSQPWQAALFEKTRLLCGATLIAPRWLLTAAHCLKPRYIVHLGQHNLQKEEGCEQTRTATESFPHPGFNNSLPNKDHRNDIMLVKMASPVSITWAVRPLTLSSRCVTAGTSCLISGWGSTSSPQLRLPHTLRCANITIIEHQKCENAYPGNITDTMVCASVQEGGKDSCQGDSGGPLVCNQSLQGIISWGQDPCAITRKPGVYTKVCKYVDWIQETMKNN

  • Protein Length

    Full Length of Isoform-1 Mature Protein

  • Molecular Weight

    35.0 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Kallikrein-11 (KLK11) is a member of the kallikrein family of serine proteases, which play critical roles in various physiological processes, including blood pressure regulation, reproductive functions, and cancer progression. Research on KLK11 has garnered attention due to its potential involvement in cancer biology, particularly in prostate and ovarian cancers, where abnormal expression levels have been linked to tumorigenesis and metastasis. The interest in KLK11 extends beyond cancer, as it may also play a role in regulating inflammation and neurodegenerative disorders. As a glycosylated protein, KLK11's structure is complex, involving post-translational modifications that influence its activity and stability. Given its physiological significance, the production of recombinant KLK11 protein is pivotal for studying its biochemical properties and elucidating its functions. Overcoming challenges in expression, purification, and activity assessment is essential for advancing our understanding of KLK11's roles in health and disease. Investigating recombinant KLK11 not only contributes to the fundamental knowledge of kallikrein-related proteases but also has potential implications for therapeutic strategies aimed at targeting KLK11 in pathological conditions. Overall, KLK11 represents a fascinating subject for further exploration in protease research.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US