Analytical Data
-
Gene name
Carbonic Anhydrase VIII/CA8
-
简介
Despite its name, the carbonic anhydrase VIII (CA8) protein lacks carbonic anhydrase catalytic activity. This distinguishes CA8 from its typical functions related to carbonic anhydrase, an enzyme known for its ability to catalyze the reversible hydration of carbon dioxide. Carbonic Anhydrase VIII/CA8 Protein, Mouse (His) is the recombinant mouse-derived Carbonic Anhydrase VIII/CA8 protein, expressed by E. coli , with C-His labeled tag.
- Application
-
Alternative Names
Carbonic Anhydrase-Related Protein; CARP; Carbonic Anhydrase VIII; CA8; CALS
-
Species
Mouse
-
Source
E. coli
-
Tag
C-6*His
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
P28651
-
Expression Region
M1-Q291
-
AA Sequence
MADLSFIEDAVAFPEKEEDEEEEEEEGVEWGYEEGVEWGLVFPDANGEYQSPINLNSREARYDPSLLDVRLSPNYVVCRDCEVTNDGHTIQVILKSKSVLSGGPLPQGQEFELYEVRFHWGRENQRGSEHTVNFKAFPMELHLIHWNSTLFGSIDEAVGKPHGIAIIALFVQIGKEHVGLKAVTEILQDIQYKGKSKTIPCFNPNTLLPDPLLRDYWVYEGSLTIPPCSEGVTWILFRYPLTISQMQIEEFRRLRTHVKGAELVEGCDGILGDNFRPTQPLSDRVIRAAFQ
-
Protein Length
Full Length
-
Molecular Weight
35 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Carbonic Anhydrase VIII (CA8) is a member of the carbonic anhydrase enzyme family, which plays a critical role in regulating acid-base homeostasis and facilitating various physiological processes by catalyzing the reversible conversion of carbon dioxide and water to bicarbonate and protons. CA8 is predominantly expressed in the brain and has been implicated in neuronal signaling, synaptic transmission, and possibly the modulation of respiratory functions. Its dysfunction or altered expression levels are associated with several neurological disorders, including epilepsy and various neurodegenerative diseases. Research on recombinant CA8 protein has gained momentum as scientists aim to elucidate its specific biochemical properties, catalytic mechanisms, and physiological roles. Producing recombinant CA8 allows for detailed structural and functional analyses, paving the way for potential therapeutic applications targeting neurological conditions. Furthermore, understanding CA8's involvement in ion transport and its interaction with other cellular components may provide insights into its unique role in brain physiology and pathology. Overall, the study of recombinant CA8 protein is essential for developing novel strategies for diagnosing and treating related disorders, making it a significant focus within the fields of biochemistry, neurobiology, and molecular medicine.
