Analytical Data
-
Gene name
MUC-17
-
简介
MUC-17 protein maintains mucosal homeostasis, contributing to environmental stability. Interacting via its C-terminus, MUC-17 crucially associates with PDZK1, ensuring proper cellular localization. MUC-17 Protein, Human (HEK293, His) is the recombinant human-derived MUC-17 protein, expressed by HEK293 , with C-His labeled tag.
- Application
-
Alternative Names
Mucin-17; MUC-17; MUC17; MUC-3; MUC3
-
Species
Human
-
Source
HEK293
-
Tag
C-His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q685J3-1
-
Expression Region
R4131-L4390
-
AA Sequence
RTTTCFGDGCQNTASRCKNGGTWDGLKCQCPNLYYGELCEEVVSSIDIGPPETISAQMELTVTVTSVKFTEELKNHSSQEFQEFKQTFTEQMNIVYSGIPEYVGVNITKLRLGSVVVEHDVLLRTKYTPEYKTVLDNATEVVKEKITKVTTQQIMINDICSDMMCFNTTGTQVQNITVTQYDPEEDCRKMAKEYGDYFVVEYRDQKPYCISPCEPGFSVSKNCNLGKCQMSLSGPQCLCVTTETHWYSGETCNQGTQKSL
-
Protein Length
Partial
-
Molecular Weight
20-35 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MUC-17, a member of the mucin family of glycoproteins, is primarily expressed in epithelial tissues and plays a crucial role in maintaining mucosal barrier integrity and facilitating cell signaling processes. Research has increasingly focused on MUC-17 due to its potential implications in various diseases, including cancer, where it may influence tumor progression and metastasis. Studies have shown that alterations in MUC-17 expression can correlate with disease states, making it a promising biomarker for diagnosis and prognosis. Additionally, the investigation of MUC-17's structure and function can provide insights into its role in pathogen interactions and immune responses. The development of recombinant MUC-17 protein has enabled researchers to explore its biochemical properties and functional mechanisms in vitro and in vivo. This lines of research not only contribute to our understanding of mucosal biology but also pave the way for novel therapeutic approaches targeting MUC-17 in disease management. Overall, MUC-17 continues to be a focal point for translational research, with ongoing studies aimed at elucidating its multifaceted roles in health and disease.











