Cat: IPD-X26224

Recombinant Human MUC-17 Protein (HEK293),His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    MUC-17

  • 简介

    MUC-17 protein maintains mucosal homeostasis, contributing to environmental stability. Interacting via its C-terminus, MUC-17 crucially associates with PDZK1, ensuring proper cellular localization. MUC-17 Protein, Human (HEK293, His) is the recombinant human-derived MUC-17 protein, expressed by HEK293 , with C-His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Mucin-17; MUC-17; MUC17; MUC-3; MUC3

  • Species

    Human

  • Source

    HEK293

  • Tag

    C-His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q685J3-1

  • Expression Region

    R4131-L4390

  • AA Sequence

    RTTTCFGDGCQNTASRCKNGGTWDGLKCQCPNLYYGELCEEVVSSIDIGPPETISAQMELTVTVTSVKFTEELKNHSSQEFQEFKQTFTEQMNIVYSGIPEYVGVNITKLRLGSVVVEHDVLLRTKYTPEYKTVLDNATEVVKEKITKVTTQQIMINDICSDMMCFNTTGTQVQNITVTQYDPEEDCRKMAKEYGDYFVVEYRDQKPYCISPCEPGFSVSKNCNLGKCQMSLSGPQCLCVTTETHWYSGETCNQGTQKSL

  • Protein Length

    Partial

  • Molecular Weight

    20-35 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

MUC-17, a member of the mucin family of glycoproteins, is primarily expressed in epithelial tissues and plays a crucial role in maintaining mucosal barrier integrity and facilitating cell signaling processes. Research has increasingly focused on MUC-17 due to its potential implications in various diseases, including cancer, where it may influence tumor progression and metastasis. Studies have shown that alterations in MUC-17 expression can correlate with disease states, making it a promising biomarker for diagnosis and prognosis. Additionally, the investigation of MUC-17's structure and function can provide insights into its role in pathogen interactions and immune responses. The development of recombinant MUC-17 protein has enabled researchers to explore its biochemical properties and functional mechanisms in vitro and in vivo. This lines of research not only contribute to our understanding of mucosal biology but also pave the way for novel therapeutic approaches targeting MUC-17 in disease management. Overall, MUC-17 continues to be a focal point for translational research, with ongoing studies aimed at elucidating its multifaceted roles in health and disease.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US